BLASTX nr result
ID: Glycyrrhiza28_contig00041041
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041041 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERF82200.1 hypothetical protein C207_04578 [Bradyrhizobium sp. D... 136 2e-40 >ERF82200.1 hypothetical protein C207_04578 [Bradyrhizobium sp. DFCI-1] Length = 81 Score = 136 bits (342), Expect = 2e-40 Identities = 65/65 (100%), Positives = 65/65 (100%) Frame = -3 Query: 195 ARVRPANPGRFAKPGAPGAHSPREGATGAARDAPEQRLFRFRPGCAFPSVIVDLVDETAR 16 ARVRPANPGRFAKPGAPGAHSPREGATGAARDAPEQRLFRFRPGCAFPSVIVDLVDETAR Sbjct: 3 ARVRPANPGRFAKPGAPGAHSPREGATGAARDAPEQRLFRFRPGCAFPSVIVDLVDETAR 62 Query: 15 KRMKT 1 KRMKT Sbjct: 63 KRMKT 67