BLASTX nr result
ID: Glycyrrhiza28_contig00040660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040660 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_051404399.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 83 1e-17 >WP_051404399.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] OCX32610.1 hypothetical protein QU42_03565 [Bradyrhizobium sp. UASWS1016] Length = 208 Score = 82.8 bits (203), Expect = 1e-17 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 DDAKKRETARTDFSRLDKVIDALIDLEEPAGLVIGRKQTPS 125 DDAKKRETARTDFSRLDKVIDALIDLEEPAGLVIGRKQTPS Sbjct: 162 DDAKKRETARTDFSRLDKVIDALIDLEEPAGLVIGRKQTPS 202