BLASTX nr result
ID: Glycyrrhiza28_contig00040370
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040370 (205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP47787.1 Retrovirus-related Pol polyprotein from transposon TN... 70 2e-12 KYP48079.1 Retrovirus-related Pol polyprotein from transposon TN... 69 3e-12 KYP38387.1 Retrovirus-related Pol polyprotein from transposon TN... 68 8e-12 KYP67039.1 Retrovirus-related Pol polyprotein from transposon TN... 68 1e-11 KYP61342.1 Retrovirus-related Pol polyprotein from transposon TN... 68 1e-11 KYP40443.1 Retrovirus-related Pol polyprotein from transposon TN... 67 3e-11 KYP41981.1 Retrovirus-related Pol polyprotein from transposon TN... 67 3e-11 GAU33749.1 hypothetical protein TSUD_52820 [Trifolium subterraneum] 67 3e-11 KYP65286.1 Retrovirus-related Pol polyprotein from transposon TN... 67 3e-11 GAU29466.1 hypothetical protein TSUD_65010 [Trifolium subterraneum] 67 3e-11 KYP70184.1 Retrovirus-related Pol polyprotein from transposon TN... 65 3e-11 KYP53274.1 Retrovirus-related Pol polyprotein from transposon TN... 66 4e-11 KYP51497.1 Retrovirus-related Pol polyprotein from transposon TN... 66 4e-11 KYP56498.1 Retrovirus-related Pol polyprotein from transposon TN... 65 5e-11 KYP78233.1 Retrovirus-related Pol polyprotein from transposon TN... 66 5e-11 KYP75335.1 Retrovirus-related Pol polyprotein from transposon TN... 65 7e-11 KYP34577.1 Retrovirus-related Pol polyprotein from transposon TN... 65 7e-11 KYP34572.1 Retrovirus-related Pol polyprotein from transposon TN... 65 7e-11 KYP40244.1 Retrovirus-related Pol polyprotein from transposon TN... 65 7e-11 GAU34785.1 hypothetical protein TSUD_205890 [Trifolium subterran... 65 7e-11 >KYP47787.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1299 Score = 69.7 bits (169), Expect = 2e-12 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHTV 131 LGYSL+HKGYKC++ +GRI+ISKDV+FNE RFPY ++F S +V Sbjct: 801 LGYSLTHKGYKCLSKSGRIYISKDVVFNENRFPYLDLFVSKSV 843 >KYP48079.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 302 Score = 68.9 bits (167), Expect = 3e-12 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSH 125 LGYS SHKGYKC++ G+IFISKDV+FNE RFPY E+F H Sbjct: 262 LGYSTSHKGYKCLSPIGKIFISKDVVFNEYRFPYHELFPHH 302 >KYP38387.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 600 Score = 68.2 bits (165), Expect = 8e-12 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHTV 131 LGYS +HKGYKC++ +GRI+ISKDV+FNE RFPY ++F S +V Sbjct: 382 LGYSPTHKGYKCLSKSGRIYISKDVVFNESRFPYQDLFVSKSV 424 >KYP67039.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1279 Score = 67.8 bits (164), Expect = 1e-11 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMF 116 LGYS SHKGYKC++S+GRI+ISKDVIFNE RFPY ++F Sbjct: 614 LGYSNSHKGYKCLSSSGRIYISKDVIFNEHRFPYTDLF 651 >KYP61342.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1358 Score = 67.8 bits (164), Expect = 1e-11 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMF 116 LGYS SHKGYKC++S+GRI+ISKDVIFNE RFPY ++F Sbjct: 693 LGYSNSHKGYKCLSSSGRIYISKDVIFNEHRFPYTDLF 730 >KYP40443.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 488 Score = 66.6 bits (161), Expect = 3e-11 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHT 128 LGYS SHKGYKC++ +GRI+ISKDVIFNE RFPY ++F + T Sbjct: 251 LGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPYNDLFVTTT 292 >KYP41981.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 498 Score = 66.6 bits (161), Expect = 3e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSH 125 LGYS SHKGYKC++ GRIFISKDV+FNE RFPY ++F ++ Sbjct: 192 LGYSSSHKGYKCLSPTGRIFISKDVVFNEYRFPYYDLFPNN 232 >GAU33749.1 hypothetical protein TSUD_52820 [Trifolium subterraneum] Length = 730 Score = 66.6 bits (161), Expect = 3e-11 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTS 122 LGYS HKGYKC++S GR+FISKDV+FNE RFPY ++F S Sbjct: 526 LGYSPVHKGYKCLDSTGRVFISKDVVFNESRFPYNDLFPS 565 >KYP65286.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 904 Score = 66.6 bits (161), Expect = 3e-11 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHT 128 LGYS SHKGYKC++ +GRI+ISKDVIFNE RFPY ++F + T Sbjct: 720 LGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPYNDLFVTTT 761 >GAU29466.1 hypothetical protein TSUD_65010 [Trifolium subterraneum] Length = 1362 Score = 66.6 bits (161), Expect = 3e-11 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTS 122 LGYS HKGYKC++S GR+FISKDV+FNE RFPY ++F S Sbjct: 785 LGYSPVHKGYKCLDSTGRVFISKDVVFNESRFPYNDLFPS 824 >KYP70184.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 243 Score = 65.5 bits (158), Expect = 3e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHT 128 LGYS SHKGYKC++++G+I+ISKDVIFNE RFPY ++F HT Sbjct: 94 LGYSNSHKGYKCLSASGKIYISKDVIFNETRFPYLDLF-QHT 134 >KYP53274.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 839 Score = 66.2 bits (160), Expect = 4e-11 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHT 128 LGYS SHKGYKC+ +GR+FISKDVIF E RFPYP +F+ T Sbjct: 402 LGYSTSHKGYKCLAPSGRVFISKDVIFCENRFPYPTLFSPST 443 >KYP51497.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 872 Score = 66.2 bits (160), Expect = 4e-11 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHT 128 LGYS SHKGYKC++ +GRI+ISKDVIFNE RFPY ++F + T Sbjct: 382 LGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPYNDLFITTT 423 >KYP56498.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 297 Score = 65.5 bits (158), Expect = 5e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHT 128 LGYS SHKGYKC++++G+I+ISKDVIFNE RFPY ++F HT Sbjct: 141 LGYSNSHKGYKCLSASGKIYISKDVIFNETRFPYLDLF-QHT 181 >KYP78233.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 540 Score = 65.9 bits (159), Expect = 5e-11 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTS 122 LGYS SHKGYKC+ + GR++ISKDVIFNE +FPY +FTS Sbjct: 141 LGYSTSHKGYKCLAADGRLYISKDVIFNEAKFPYKTLFTS 180 >KYP75335.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 537 Score = 65.5 bits (158), Expect = 7e-11 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMF 116 LGYS SHKGYKC+ GRIFISKDVIF E RFPYP +F Sbjct: 291 LGYSTSHKGYKCLAPTGRIFISKDVIFCETRFPYPSLF 328 >KYP34577.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 661 Score = 65.5 bits (158), Expect = 7e-11 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHT 128 LGYS SHKGYKC+ +GRIFISKDVIF E FPYP MF T Sbjct: 367 LGYSTSHKGYKCLAPSGRIFISKDVIFCENHFPYPSMFPPST 408 >KYP34572.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 682 Score = 65.5 bits (158), Expect = 7e-11 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHT 128 LGYS SHKGYKC+ +GRIFISKDVIF E FPYP MF T Sbjct: 388 LGYSTSHKGYKCLAPSGRIFISKDVIFCENHFPYPSMFPPST 429 >KYP40244.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 720 Score = 65.5 bits (158), Expect = 7e-11 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMF 116 LGYS SHKGYKC++S+ RI+ISKDVIFNE RFPY ++F Sbjct: 683 LGYSNSHKGYKCLSSSSRIYISKDVIFNEHRFPYTDLF 720 >GAU34785.1 hypothetical protein TSUD_205890 [Trifolium subterraneum] Length = 888 Score = 65.5 bits (158), Expect = 7e-11 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +3 Query: 3 LGYSLSHKGYKCMNSAGRIFISKDVIFNEMRFPYPEMFTSHT 128 LGYS +HKGYKC++ GRI++SKDVIFNE RFPY +F + T Sbjct: 620 LGYSTTHKGYKCLSPTGRIYVSKDVIFNEQRFPYKILFPTQT 661