BLASTX nr result
ID: Glycyrrhiza28_contig00040223
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040223 (320 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP66570.1 Pentatricopeptide repeat-containing protein At2g13600... 75 1e-13 XP_017426801.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 2e-12 XP_014519660.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 6e-12 KHN41822.1 Pentatricopeptide repeat-containing protein [Glycine ... 70 8e-12 KRH28916.1 hypothetical protein GLYMA_11G085600 [Glycine max] 70 1e-11 XP_007158002.1 hypothetical protein PHAVU_002G116300g [Phaseolus... 70 1e-11 KHN35960.1 Pentatricopeptide repeat-containing protein [Glycine ... 68 5e-11 XP_006573532.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 5e-11 XP_003612353.2 PPR containing plant-like protein [Medicago trunc... 65 3e-10 GAU29814.1 hypothetical protein TSUD_223600 [Trifolium subterran... 65 4e-10 OIV92742.1 hypothetical protein TanjilG_00876 [Lupinus angustifo... 62 5e-09 XP_019422771.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 5e-09 XP_016182252.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 5e-08 XP_015950660.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 5e-08 XP_004512264.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 5e-08 XP_010649451.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 2e-07 XP_010266186.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 9e-06 >KYP66570.1 Pentatricopeptide repeat-containing protein At2g13600 family [Cajanus cajan] Length = 599 Score = 75.1 bits (183), Expect = 1e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+IGEGKWEEALKCREKMAKIRVKKDPGSSWLI Sbjct: 565 SNIYIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 599 >XP_017426801.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Vigna angularis] XP_017426805.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Vigna angularis] KOM45289.1 hypothetical protein LR48_Vigan06g059500 [Vigna angularis] KOM45290.1 hypothetical protein LR48_Vigan06g059600 [Vigna angularis] BAT99878.1 hypothetical protein VIGAN_10141700 [Vigna angularis var. angularis] Length = 766 Score = 72.0 bits (175), Expect = 2e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+ GEGKWEEALKCREKMAKIR+KKDPGSSWLI Sbjct: 732 SNIYTGEGKWEEALKCREKMAKIRLKKDPGSSWLI 766 >XP_014519660.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Vigna radiata var. radiata] Length = 766 Score = 70.5 bits (171), Expect = 6e-12 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+ GEGKWEEAL+CREKMAKIR+KKDPGSSWLI Sbjct: 732 SNIYTGEGKWEEALQCREKMAKIRLKKDPGSSWLI 766 >KHN41822.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 351 Score = 69.7 bits (169), Expect = 8e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 S I+IGEGKWEEALKCRE+MAKI VKKDPGSSWLI Sbjct: 317 SGIYIGEGKWEEALKCRERMAKIHVKKDPGSSWLI 351 >KRH28916.1 hypothetical protein GLYMA_11G085600 [Glycine max] Length = 704 Score = 69.7 bits (169), Expect = 1e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 S I+IGEGKWEEALKCRE+MAKI VKKDPGSSWLI Sbjct: 670 SGIYIGEGKWEEALKCRERMAKIHVKKDPGSSWLI 704 >XP_007158002.1 hypothetical protein PHAVU_002G116300g [Phaseolus vulgaris] ESW29996.1 hypothetical protein PHAVU_002G116300g [Phaseolus vulgaris] Length = 766 Score = 69.7 bits (169), Expect = 1e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+ GEGKWEEALKCREKMAKI +KKDPGSSWLI Sbjct: 732 SNIYTGEGKWEEALKCREKMAKISLKKDPGSSWLI 766 >KHN35960.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 687 Score = 67.8 bits (164), Expect = 5e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+IGEGKWEEALKCRE+M +I VKKDPGSSWLI Sbjct: 653 SNIYIGEGKWEEALKCRERMTEICVKKDPGSSWLI 687 >XP_006573532.1 PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Glycine max] KRH76544.1 hypothetical protein GLYMA_01G159100 [Glycine max] Length = 766 Score = 67.8 bits (164), Expect = 5e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+IGEGKWEEALKCRE+M +I VKKDPGSSWLI Sbjct: 732 SNIYIGEGKWEEALKCRERMTEICVKKDPGSSWLI 766 >XP_003612353.2 PPR containing plant-like protein [Medicago truncatula] AES95311.2 PPR containing plant-like protein [Medicago truncatula] Length = 754 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+I EG WEEAL CR+KMAKIRVKKDPG+SWLI Sbjct: 720 SNIYIEEGNWEEALNCRKKMAKIRVKKDPGNSWLI 754 >GAU29814.1 hypothetical protein TSUD_223600 [Trifolium subterraneum] Length = 687 Score = 65.1 bits (157), Expect = 4e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+ EGKWEEA+KCREKMAKIRVK+DP SSWLI Sbjct: 653 SNIYTVEGKWEEAVKCREKMAKIRVKRDPASSWLI 687 >OIV92742.1 hypothetical protein TanjilG_00876 [Lupinus angustifolius] Length = 686 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+ G+GKWEEA+K REKMAKI VKK PGSSWLI Sbjct: 652 SNIYTGDGKWEEAVKWREKMAKINVKKGPGSSWLI 686 >XP_019422771.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Lupinus angustifolius] Length = 764 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+ G+GKWEEA+K REKMAKI VKK PGSSWLI Sbjct: 730 SNIYTGDGKWEEAVKWREKMAKINVKKGPGSSWLI 764 >XP_016182252.1 PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Arachis ipaensis] Length = 765 Score = 59.3 bits (142), Expect = 5e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+ EGKWEEALK REKMAK V+KDPG+SWL+ Sbjct: 731 SNIYSAEGKWEEALKWREKMAKSHVRKDPGNSWLV 765 >XP_015950660.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Arachis duranensis] Length = 765 Score = 59.3 bits (142), Expect = 5e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SNI+ EGKWEEALK REKMAK V+KDPG+SWL+ Sbjct: 731 SNIYSAEGKWEEALKWREKMAKSHVRKDPGNSWLV 765 >XP_004512264.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Cicer arietinum] Length = 765 Score = 59.3 bits (142), Expect = 5e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SN+++ E KWEEALKCREKMA VKKDPGSSWLI Sbjct: 731 SNLYMEERKWEEALKCREKMATSCVKKDPGSSWLI 765 >XP_010649451.1 PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Vitis vinifera] Length = 817 Score = 57.4 bits (137), Expect = 2e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SN++ GEGKWE+A K R++M +I VKKDPGSSWLI Sbjct: 739 SNLYSGEGKWEQAFKLRQRMVEIGVKKDPGSSWLI 773 >XP_010266186.1 PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Nelumbo nucifera] Length = 815 Score = 52.8 bits (125), Expect = 9e-06 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -2 Query: 319 SNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 215 SN++ G+WEEAL+ R+KMAK VKKDPG+SWL+ Sbjct: 740 SNLYSRAGRWEEALELRQKMAKAGVKKDPGNSWLV 774