BLASTX nr result
ID: Glycyrrhiza28_contig00039088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039088 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_037564919.1 hypothetical protein [Staphylococcus agnetis] 87 4e-21 CEG21162.1 hypothetical protein BN1080_00055 [Planococcus massil... 66 7e-12 >WP_037564919.1 hypothetical protein [Staphylococcus agnetis] Length = 59 Score = 87.0 bits (214), Expect = 4e-21 Identities = 42/53 (79%), Positives = 43/53 (81%) Frame = +3 Query: 90 MLLPSGPDMIHGFILHRTEIFKHYVLRADFTKIRPQQRN*VSHKADFEYREPL 248 MLLPSGPDM+HGFILH TEIFKH VL ADFT PQQRN SHKA FE REPL Sbjct: 1 MLLPSGPDMVHGFILHGTEIFKHLVLWADFTNTHPQQRNSASHKAVFENREPL 53 >CEG21162.1 hypothetical protein BN1080_00055 [Planococcus massiliensis] Length = 135 Score = 65.9 bits (159), Expect = 7e-12 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = +3 Query: 12 SNAYHKRYRSRQLNLGYPTAHMRIHLMLLPSGPDMIHGFILHRTE 146 S A HKRY R L+LG P AH + HLMLLPSGPDM+HGF L RT+ Sbjct: 35 STAAHKRYPCRWLDLGNPAAHEKFHLMLLPSGPDMVHGFPLRRTQ 79