BLASTX nr result
ID: Glycyrrhiza28_contig00038664
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00038664 (210 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERF85411.1 hypothetical protein C207_01552 [Bradyrhizobium sp. D... 103 1e-27 WP_050630787.1 hypothetical protein [Bradyrhizobium viridifuturi] 102 6e-27 WP_024584032.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 102 6e-27 WP_072823674.1 hypothetical protein [Bradyrhizobium erythrophlei... 72 4e-15 WP_069443684.1 hypothetical protein [Methyloceanibacter stevinii... 52 3e-07 WP_045368951.1 hypothetical protein [Methyloceanibacter caenitep... 52 4e-07 BAT60703.1 hypothetical protein GJW-30_1_03252 [Variibacter gotj... 50 3e-06 >ERF85411.1 hypothetical protein C207_01552 [Bradyrhizobium sp. DFCI-1] Length = 84 Score = 103 bits (258), Expect = 1e-27 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +2 Query: 59 MSNDQPPPLAKPFWRRGLAGVLDFITVFFGGDYAIGAATGQTTKDGFSLT 208 MSNDQPPPLAKPFWRRGLAG+LDFITVFFGG YAIGAATGQTTKDGFSLT Sbjct: 1 MSNDQPPPLAKPFWRRGLAGLLDFITVFFGGGYAIGAATGQTTKDGFSLT 50 >WP_050630787.1 hypothetical protein [Bradyrhizobium viridifuturi] Length = 84 Score = 102 bits (253), Expect = 6e-27 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 59 MSNDQPPPLAKPFWRRGLAGVLDFITVFFGGDYAIGAATGQTTKDGFSLT 208 MSNDQPPPLAKPFWRRGLAG LDFITVFFGG YAIGAATGQTTKDGF+LT Sbjct: 1 MSNDQPPPLAKPFWRRGLAGFLDFITVFFGGGYAIGAATGQTTKDGFNLT 50 >WP_024584032.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KIU48381.1 hypothetical protein QU41_15625 [Bradyrhizobium elkanii] OCX30869.1 hypothetical protein QU42_11990 [Bradyrhizobium sp. UASWS1016] Length = 84 Score = 102 bits (253), Expect = 6e-27 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 59 MSNDQPPPLAKPFWRRGLAGVLDFITVFFGGDYAIGAATGQTTKDGFSLT 208 MSNDQPPPLAKPFWRRGLAG LDFITVFFGG YAIGAATGQTTKDGF+LT Sbjct: 1 MSNDQPPPLAKPFWRRGLAGFLDFITVFFGGGYAIGAATGQTTKDGFNLT 50 >WP_072823674.1 hypothetical protein [Bradyrhizobium erythrophlei] SHN85046.1 RDD family protein [Bradyrhizobium erythrophlei] Length = 89 Score = 72.4 bits (176), Expect = 4e-15 Identities = 35/45 (77%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = +2 Query: 77 PPLAKP-FWRRGLAGVLDFITVFFGGDYAIGAATGQTTKDGFSLT 208 P LA+P FWRRGLAGVLDF TVFF G Y IGA TG+TTKDGF+LT Sbjct: 8 PTLARPAFWRRGLAGVLDFFTVFFVGGYLIGALTGETTKDGFNLT 52 >WP_069443684.1 hypothetical protein [Methyloceanibacter stevinii] ODR96353.1 hypothetical protein AUC70_15875 [Methyloceanibacter stevinii] Length = 87 Score = 52.4 bits (124), Expect = 3e-07 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 4/50 (8%) Frame = +2 Query: 68 DQPPPL--AKPF--WRRGLAGVLDFITVFFGGDYAIGAATGQTTKDGFSL 205 D PP + A+P WR+ LAG+LDF T+FF YAIG ATG T +GF L Sbjct: 3 DTPPDMSTAQPVSTWRKVLAGILDFFTIFFVAGYAIGYATGNLTAEGFEL 52 >WP_045368951.1 hypothetical protein [Methyloceanibacter caenitepidi] BAQ18691.1 hypothetical protein GL4_3266 [Methyloceanibacter caenitepidi] Length = 87 Score = 52.0 bits (123), Expect = 4e-07 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 5/50 (10%) Frame = +2 Query: 71 QPPPL---AKPF--WRRGLAGVLDFITVFFGGDYAIGAATGQTTKDGFSL 205 + PP+ AKP WR+ LAG+LDF T+FF Y IG ATG T DGF L Sbjct: 3 ETPPVTSEAKPVSTWRKVLAGILDFFTIFFVAGYVIGYATGSLTADGFEL 52 >BAT60703.1 hypothetical protein GJW-30_1_03252 [Variibacter gotjawalensis] Length = 81 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/47 (48%), Positives = 30/47 (63%) Frame = +2 Query: 65 NDQPPPLAKPFWRRGLAGVLDFITVFFGGDYAIGAATGQTTKDGFSL 205 +D P P WR+ +A +LDF+TVFF G Y +GA+TG T GF L Sbjct: 2 SDVPTPQVAT-WRKVVAAILDFLTVFFVGGYIVGASTGNLTSSGFKL 47