BLASTX nr result
ID: Glycyrrhiza28_contig00037879
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037879 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003599324.1 Serine/Threonine kinase, plant-type protein [Medi... 86 3e-17 KHN25079.1 Putative receptor protein kinase ZmPK1 [Glycine soja] 85 1e-16 KRH48732.1 hypothetical protein GLYMA_07G108200 [Glycine max] 85 1e-16 XP_003530178.2 PREDICTED: putative receptor protein kinase ZmPK1... 85 1e-16 XP_007134561.1 hypothetical protein PHAVU_010G057600g [Phaseolus... 84 2e-16 XP_007134560.1 hypothetical protein PHAVU_010G057500g [Phaseolus... 84 2e-16 XP_003521853.2 PREDICTED: putative receptor protein kinase ZmPK1... 84 2e-16 KYP76668.1 Putative receptor protein kinase ZmPK1 [Cajanus cajan] 84 2e-16 GAU27281.1 hypothetical protein TSUD_125630 [Trifolium subterran... 84 2e-16 GAU27282.1 hypothetical protein TSUD_125620 [Trifolium subterran... 84 2e-16 KHN42142.1 Putative receptor protein kinase ZmPK1 [Glycine soja] 83 4e-16 KHN42140.1 Putative receptor protein kinase ZmPK1 [Glycine soja] 83 4e-16 XP_003521851.1 PREDICTED: putative receptor protein kinase ZmPK1... 83 4e-16 GAU27628.1 hypothetical protein TSUD_125740 [Trifolium subterran... 80 9e-16 XP_007134556.1 hypothetical protein PHAVU_010G057100g [Phaseolus... 82 1e-15 XP_014522921.1 PREDICTED: putative receptor protein kinase ZmPK1... 81 2e-15 XP_007134941.1 hypothetical protein PHAVU_010G088500g [Phaseolus... 80 3e-15 XP_007134942.1 hypothetical protein PHAVU_010G088500g [Phaseolus... 80 3e-15 XP_017440889.1 PREDICTED: putative receptor protein kinase ZmPK1... 80 6e-15 XP_003599321.1 Serine/Threonine kinase, plant-type protein [Medi... 79 1e-14 >XP_003599324.1 Serine/Threonine kinase, plant-type protein [Medicago truncatula] AES69575.1 Serine/Threonine kinase, plant-type protein [Medicago truncatula] Length = 800 Score = 86.3 bits (212), Expect = 3e-17 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALG NYDIVQ++TLA VALDCVE+EKD RP+MSQV ERL+SH+HDS Sbjct: 751 IVDPALGLNYDIVQLKTLAVVALDCVEKEKDVRPTMSQVVERLQSHQHDS 800 >KHN25079.1 Putative receptor protein kinase ZmPK1 [Glycine soja] Length = 736 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGSNYD+ QME LATVAL+CV+E+KD RPSMSQVAERL++HE+DS Sbjct: 687 IVDPALGSNYDMNQMEILATVALECVDEDKDVRPSMSQVAERLQNHENDS 736 >KRH48732.1 hypothetical protein GLYMA_07G108200 [Glycine max] Length = 808 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGSNYD+ QME LATVAL+CV+E+KD RPSMSQVAERL++HE+DS Sbjct: 759 IVDPALGSNYDMNQMEILATVALECVDEDKDVRPSMSQVAERLQNHENDS 808 >XP_003530178.2 PREDICTED: putative receptor protein kinase ZmPK1 [Glycine max] Length = 859 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGSNYD+ QME LATVAL+CV+E+KD RPSMSQVAERL++HE+DS Sbjct: 810 IVDPALGSNYDMNQMEILATVALECVDEDKDVRPSMSQVAERLQNHENDS 859 >XP_007134561.1 hypothetical protein PHAVU_010G057600g [Phaseolus vulgaris] ESW06555.1 hypothetical protein PHAVU_010G057600g [Phaseolus vulgaris] Length = 806 Score = 84.3 bits (207), Expect = 2e-16 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGSNYD+ +ME LATVAL+CVEEEK+ RP+MSQVAERL++H+HDS Sbjct: 756 IVDPALGSNYDMNEMEILATVALECVEEEKNVRPNMSQVAERLQNHDHDS 805 >XP_007134560.1 hypothetical protein PHAVU_010G057500g [Phaseolus vulgaris] ESW06554.1 hypothetical protein PHAVU_010G057500g [Phaseolus vulgaris] Length = 806 Score = 84.3 bits (207), Expect = 2e-16 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGSNYD+ +ME LATVAL+CVEEEK+ RP+MSQVAERL++H+HDS Sbjct: 756 IVDPALGSNYDMNEMEILATVALECVEEEKNARPNMSQVAERLQNHDHDS 805 >XP_003521853.2 PREDICTED: putative receptor protein kinase ZmPK1 [Glycine max] KRH64889.1 hypothetical protein GLYMA_03G002900 [Glycine max] Length = 814 Score = 84.3 bits (207), Expect = 2e-16 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGS+YD+ +ME LAT+AL+CVEEEKD RPSMS VAERL+SHEHDS Sbjct: 765 IVDPALGSDYDMNKMEMLATMALECVEEEKDVRPSMSHVAERLQSHEHDS 814 >KYP76668.1 Putative receptor protein kinase ZmPK1 [Cajanus cajan] Length = 614 Score = 84.0 bits (206), Expect = 2e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 I+DPAL SNYD+ +ME LATVALDCVEEEKD RPSMSQV ERL+SHEH S Sbjct: 565 IIDPALRSNYDVNEMEILATVALDCVEEEKDARPSMSQVVERLQSHEHAS 614 >GAU27281.1 hypothetical protein TSUD_125630 [Trifolium subterraneum] Length = 619 Score = 84.0 bits (206), Expect = 2e-16 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 ++DP LGSNYD+V++ETL VALDCVEEEKD RP+MSQV ERL++HEHDS Sbjct: 570 LIDPTLGSNYDMVKLETLTMVALDCVEEEKDMRPNMSQVVERLQTHEHDS 619 >GAU27282.1 hypothetical protein TSUD_125620 [Trifolium subterraneum] Length = 725 Score = 84.0 bits (206), Expect = 2e-16 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 I+DP LGSNYD+V++ETL VALDCVEEEKD RP+MSQV ERL++HEHDS Sbjct: 676 ILDPTLGSNYDMVKLETLTMVALDCVEEEKDMRPNMSQVVERLQTHEHDS 725 >KHN42142.1 Putative receptor protein kinase ZmPK1 [Glycine soja] Length = 732 Score = 83.2 bits (204), Expect = 4e-16 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGS+YD+ +ME LAT+AL+CVEEEKD RP+MS VAERL+SHEHDS Sbjct: 683 IVDPALGSDYDMNKMEMLATMALECVEEEKDVRPTMSHVAERLQSHEHDS 732 >KHN42140.1 Putative receptor protein kinase ZmPK1 [Glycine soja] Length = 791 Score = 83.2 bits (204), Expect = 4e-16 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGS+YD+ +ME LAT+AL+CVEEEKD RP+MS VAERL+SHEHDS Sbjct: 742 IVDPALGSDYDMNKMEMLATMALECVEEEKDVRPTMSHVAERLQSHEHDS 791 >XP_003521851.1 PREDICTED: putative receptor protein kinase ZmPK1 [Glycine max] KRH64887.1 hypothetical protein GLYMA_03G002700 [Glycine max] Length = 801 Score = 83.2 bits (204), Expect = 4e-16 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGS+YD+ +ME LAT+AL+CVEEEKD RP+MS VAERL+SHEHDS Sbjct: 752 IVDPALGSDYDMNKMEMLATMALECVEEEKDVRPTMSHVAERLQSHEHDS 801 >GAU27628.1 hypothetical protein TSUD_125740 [Trifolium subterraneum] Length = 254 Score = 80.1 bits (196), Expect = 9e-16 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEH 229 IVDP LGSNYD+ +METLA VALDCV EEKD RP+MSQV ERL SHEH Sbjct: 202 IVDPKLGSNYDVKRMETLANVALDCVVEEKDVRPTMSQVVERLLSHEH 249 >XP_007134556.1 hypothetical protein PHAVU_010G057100g [Phaseolus vulgaris] ESW06550.1 hypothetical protein PHAVU_010G057100g [Phaseolus vulgaris] Length = 799 Score = 82.0 bits (201), Expect = 1e-15 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDPALGSNYD +ME LATVAL+CVEEEKD RPSMS V ER++SHEH+S Sbjct: 750 IVDPALGSNYDRNEMEILATVALECVEEEKDVRPSMSHVVERIQSHEHNS 799 >XP_014522921.1 PREDICTED: putative receptor protein kinase ZmPK1 [Vigna radiata var. radiata] Length = 803 Score = 80.9 bits (198), Expect = 2e-15 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDP LGS+Y++ +ME LATVAL+CVEEEKD RPSMSQV ERL+SHEH S Sbjct: 754 IVDPTLGSDYNVKKMEILATVALECVEEEKDVRPSMSQVVERLQSHEHGS 803 >XP_007134941.1 hypothetical protein PHAVU_010G088500g [Phaseolus vulgaris] ESW06935.1 hypothetical protein PHAVU_010G088500g [Phaseolus vulgaris] Length = 727 Score = 80.5 bits (197), Expect = 3e-15 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDP LGS+Y++ Q+E LA VALDCVEEEKD RPSMSQV ERL+SHEH S Sbjct: 678 IVDPTLGSDYNVKQLEILAKVALDCVEEEKDVRPSMSQVVERLQSHEHGS 727 >XP_007134942.1 hypothetical protein PHAVU_010G088500g [Phaseolus vulgaris] ESW06936.1 hypothetical protein PHAVU_010G088500g [Phaseolus vulgaris] Length = 799 Score = 80.5 bits (197), Expect = 3e-15 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDP LGS+Y++ Q+E LA VALDCVEEEKD RPSMSQV ERL+SHEH S Sbjct: 750 IVDPTLGSDYNVKQLEILAKVALDCVEEEKDVRPSMSQVVERLQSHEHGS 799 >XP_017440889.1 PREDICTED: putative receptor protein kinase ZmPK1 [Vigna angularis] KOM57403.1 hypothetical protein LR48_Vigan11g043600 [Vigna angularis] BAT97842.1 hypothetical protein VIGAN_09141100 [Vigna angularis var. angularis] Length = 805 Score = 79.7 bits (195), Expect = 6e-15 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDP LGS+Y++ +ME LATVAL+CVEEEKD RPSMSQV ERL++HEH S Sbjct: 756 IVDPTLGSDYNVKKMEILATVALECVEEEKDVRPSMSQVVERLQNHEHGS 805 >XP_003599321.1 Serine/Threonine kinase, plant-type protein [Medicago truncatula] AES69572.1 Serine/Threonine kinase, plant-type protein [Medicago truncatula] Length = 796 Score = 79.0 bits (193), Expect = 1e-14 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -1 Query: 372 IVDPALGSNYDIVQMETLATVALDCVEEEKDTRPSMSQVAERLRSHEHDS 223 IVDP LGSNYD+V++ETL VAL CVEEEKD RP+MS+V E L++HEHDS Sbjct: 747 IVDPTLGSNYDMVKLETLTMVALKCVEEEKDMRPNMSEVVEMLQTHEHDS 796