BLASTX nr result
ID: Glycyrrhiza28_contig00037809
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037809 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007152610.1 hypothetical protein PHAVU_004G144600g [Phaseolus... 62 1e-08 XP_006599726.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-08 XP_004515244.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-07 XP_017437816.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 8e-06 XP_014507236.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 8e-06 BAU02627.1 hypothetical protein VIGAN_11218200 [Vigna angularis ... 54 8e-06 >XP_007152610.1 hypothetical protein PHAVU_004G144600g [Phaseolus vulgaris] ESW24604.1 hypothetical protein PHAVU_004G144600g [Phaseolus vulgaris] Length = 597 Score = 62.4 bits (150), Expect = 1e-08 Identities = 32/59 (54%), Positives = 38/59 (64%) Frame = +3 Query: 243 LMGMLNRYINSLKNPSFPSCTXXXXXXXXXVFRNKSLPQIETPLQSPRFSVFHYSSNSQ 419 +MGM RYINSLKNPSF CT +FRNK L Q++T L S RFS HYS++ Q Sbjct: 1 MMGMFRRYINSLKNPSFSLCT----HHYRHIFRNKVLAQVQTTLHSTRFSPSHYSAHCQ 55 >XP_006599726.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Glycine max] XP_003548320.2 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial-like [Glycine max] KRH09497.1 hypothetical protein GLYMA_16G218600 [Glycine max] Length = 591 Score = 61.6 bits (148), Expect = 2e-08 Identities = 34/59 (57%), Positives = 39/59 (66%) Frame = +3 Query: 243 LMGMLNRYINSLKNPSFPSCTXXXXXXXXXVFRNKSLPQIETPLQSPRFSVFHYSSNSQ 419 +MGM +RYINSLKN SF S T +FRN LPQIET LQ RFS FHYS++ Q Sbjct: 1 MMGMFHRYINSLKNLSFSSRTLPYCH----IFRNNVLPQIETTLQLTRFSPFHYSAHYQ 55 >XP_004515244.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Cicer arietinum] Length = 614 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/67 (47%), Positives = 39/67 (58%) Frame = +3 Query: 222 VPKCKMMLMGMLNRYINSLKNPSFPSCTXXXXXXXXXVFRNKSLPQIETPLQSPRFSVFH 401 +PK K+M G +NR I SL N SF S T + RNK+LPQIET +S F VF Sbjct: 4 IPKHKIMFTGRINRLIRSLINHSFSSLTHHHHHYHTYLLRNKALPQIETTFKSSMFFVFQ 63 Query: 402 YSSNSQM 422 YSS Q+ Sbjct: 64 YSSYCQL 70 >XP_017437816.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna angularis] XP_017437817.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna angularis] Length = 614 Score = 54.3 bits (129), Expect = 8e-06 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = +3 Query: 243 LMGMLNRYINSLKNPSFPSCTXXXXXXXXXVFRNKSLPQIETPLQSPRFSVFHYSSNSQ 419 +MGM RY+N LK PSF C +FRNK L Q+ET L S RFS HYS + Q Sbjct: 1 MMGMFRRYMNYLKTPSFSLCIHHYRQ----IFRNKVLTQVETTLHSTRFSPSHYSVHCQ 55 >XP_014507236.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507312.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507388.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507465.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507537.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] XP_014507613.1 PREDICTED: pentatricopeptide repeat-containing protein At1g73400, mitochondrial [Vigna radiata var. radiata] Length = 614 Score = 54.3 bits (129), Expect = 8e-06 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = +3 Query: 243 LMGMLNRYINSLKNPSFPSCTXXXXXXXXXVFRNKSLPQIETPLQSPRFSVFHYSSNSQ 419 +MGM RY+N LK PSF C +FRNK L Q+ET L S RFS HYS + Q Sbjct: 1 MMGMFRRYMNYLKTPSFSLCIHHYRQ----IFRNKVLAQVETTLHSTRFSPSHYSVHCQ 55 >BAU02627.1 hypothetical protein VIGAN_11218200 [Vigna angularis var. angularis] Length = 617 Score = 54.3 bits (129), Expect = 8e-06 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = +3 Query: 243 LMGMLNRYINSLKNPSFPSCTXXXXXXXXXVFRNKSLPQIETPLQSPRFSVFHYSSNSQ 419 +MGM RY+N LK PSF C +FRNK L Q+ET L S RFS HYS + Q Sbjct: 1 MMGMFRRYMNYLKTPSFSLCIHHYRQ----IFRNKVLTQVETTLHSTRFSPSHYSVHCQ 55