BLASTX nr result
ID: Glycyrrhiza28_contig00037794
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037794 (208 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_076861577.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] 62 4e-11 WP_075968992.1 hypothetical protein [Bradyrhizobium elkanii] 60 1e-10 WP_074128550.1 hypothetical protein [Bradyrhizobium sp. NAS96.2]... 60 2e-10 WP_076829873.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-... 59 7e-10 SED08255.1 hypothetical protein SAMN05444164_3632 [Bradyrhizobiu... 59 7e-10 >WP_076861577.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] Length = 71 Score = 61.6 bits (148), Expect = 4e-11 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 112 MDLSSNDRAEQASPRRLACAACGSEFPCSLTG 207 MDLSS DR+EQASPRRLAC ACGSEF CSLTG Sbjct: 1 MDLSSTDRSEQASPRRLACTACGSEFSCSLTG 32 >WP_075968992.1 hypothetical protein [Bradyrhizobium elkanii] Length = 71 Score = 60.5 bits (145), Expect = 1e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 112 MDLSSNDRAEQASPRRLACAACGSEFPCSLTG 207 MDL+SNDR+E ASPRRLAC ACGSEF CSLTG Sbjct: 1 MDLTSNDRSEPASPRRLACTACGSEFSCSLTG 32 >WP_074128550.1 hypothetical protein [Bradyrhizobium sp. NAS96.2] OKO75694.1 hypothetical protein AC628_19855 [Bradyrhizobium sp. NAS96.2] Length = 71 Score = 60.1 bits (144), Expect = 2e-10 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 112 MDLSSNDRAEQASPRRLACAACGSEFPCSLTG 207 MDLSS DR+EQ SPRRLAC ACGSEF CSLTG Sbjct: 1 MDLSSTDRSEQVSPRRLACTACGSEFSCSLTG 32 >WP_076829873.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-321] OMI05869.1 hypothetical protein BSN85_23295 [Bradyrhizobium sp. UFLA 03-321] Length = 71 Score = 58.5 bits (140), Expect = 7e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 112 MDLSSNDRAEQASPRRLACAACGSEFPCSLTG 207 MDLSSNDR++ ASPR+LAC ACGSEF CSLTG Sbjct: 1 MDLSSNDRSKPASPRQLACTACGSEFSCSLTG 32 >SED08255.1 hypothetical protein SAMN05444164_3632 [Bradyrhizobium erythrophlei] Length = 71 Score = 58.5 bits (140), Expect = 7e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 112 MDLSSNDRAEQASPRRLACAACGSEFPCSLTG 207 MDL+S+DR+E ASPRRLAC ACGSEF CSLTG Sbjct: 1 MDLTSHDRSEPASPRRLACTACGSEFSCSLTG 32