BLASTX nr result
ID: Glycyrrhiza28_contig00037656
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037656 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU11017.1 hypothetical protein TSUD_113100 [Trifolium subterran... 158 1e-43 XP_004486725.1 PREDICTED: pentatricopeptide repeat-containing pr... 157 2e-43 KYP46914.1 Pentatricopeptide repeat-containing protein At3g16010... 148 6e-40 XP_003542104.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 5e-38 XP_014498630.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 5e-38 XP_017423149.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 7e-37 XP_007150666.1 hypothetical protein PHAVU_005G171500g [Phaseolus... 139 1e-36 XP_003597780.1 PPR containing plant-like protein [Medicago trunc... 139 1e-36 XP_014498628.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 3e-36 XP_017423148.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 3e-35 XP_019436424.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 2e-34 XP_015933687.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 3e-32 XP_016167865.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 126 4e-32 XP_002299640.2 hypothetical protein POPTR_0001s18030g [Populus t... 113 2e-27 XP_018486670.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 8e-27 XP_011002687.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 1e-26 OMO54124.1 hypothetical protein CCACVL1_28035 [Corchorus capsula... 109 3e-26 XP_018486671.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 4e-26 XP_012073332.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 5e-26 XP_011072331.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 6e-26 >GAU11017.1 hypothetical protein TSUD_113100 [Trifolium subterraneum] Length = 639 Score = 158 bits (399), Expect = 1e-43 Identities = 77/86 (89%), Positives = 81/86 (94%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYARTLDERFIRILK 180 ISTWPPFSQR+KQTENEIVQMFRLPDS E NH+ PVKGGRVLRK+P ARTLDERFIRILK Sbjct: 12 ISTWPPFSQRLKQTENEIVQMFRLPDSQEANHNLPVKGGRVLRKNPNARTLDERFIRILK 71 Query: 181 IFKWGPDAEKALEVLKIKLDTRLVRE 258 IFKWGPDAEKALEVLK+KLD RLVRE Sbjct: 72 IFKWGPDAEKALEVLKLKLDIRLVRE 97 >XP_004486725.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Cicer arietinum] Length = 638 Score = 157 bits (398), Expect = 2e-43 Identities = 76/86 (88%), Positives = 80/86 (93%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYARTLDERFIRILK 180 ISTWPPFSQR+KQTENEIVQMFRLPDS EGNH P+KGGRV RKDP AR LDERFIRILK Sbjct: 12 ISTWPPFSQRLKQTENEIVQMFRLPDSQEGNHSLPMKGGRVWRKDPIARILDERFIRILK 71 Query: 181 IFKWGPDAEKALEVLKIKLDTRLVRE 258 IFKWGPDAEKALEVLK++LDTRLVRE Sbjct: 72 IFKWGPDAEKALEVLKLRLDTRLVRE 97 >KYP46914.1 Pentatricopeptide repeat-containing protein At3g16010 family [Cajanus cajan] Length = 635 Score = 148 bits (373), Expect = 6e-40 Identities = 73/87 (83%), Positives = 81/87 (93%), Gaps = 1/87 (1%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNH-DPPVKGGRVLRKDPYARTLDERFIRIL 177 IST+PPFSQR+KQTENEIVQMFRLP+S EGNH D P+KGG LRK+PY+RTLDERFIRIL Sbjct: 9 ISTFPPFSQRLKQTENEIVQMFRLPNSHEGNHHDIPMKGGYALRKNPYSRTLDERFIRIL 68 Query: 178 KIFKWGPDAEKALEVLKIKLDTRLVRE 258 KIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 69 KIFKWGPDAEKALEVLKLKVDARLVRE 95 >XP_003542104.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Glycine max] KRH23476.1 hypothetical protein GLYMA_13G359600 [Glycine max] KRH23477.1 hypothetical protein GLYMA_13G359600 [Glycine max] Length = 631 Score = 142 bits (359), Expect = 5e-38 Identities = 70/87 (80%), Positives = 79/87 (90%), Gaps = 1/87 (1%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNH-DPPVKGGRVLRKDPYARTLDERFIRIL 177 IST+PPF QR+KQTENEI QMFRLP+S EGNH + +KGG VLR+DPY+RTLDERFIRIL Sbjct: 4 ISTFPPFCQRLKQTENEIAQMFRLPNSHEGNHLNNSMKGGHVLRRDPYSRTLDERFIRIL 63 Query: 178 KIFKWGPDAEKALEVLKIKLDTRLVRE 258 KIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 64 KIFKWGPDAEKALEVLKLKVDPRLVRE 90 >XP_014498630.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X2 [Vigna radiata var. radiata] Length = 640 Score = 142 bits (359), Expect = 5e-38 Identities = 71/87 (81%), Positives = 78/87 (89%), Gaps = 1/87 (1%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNH-DPPVKGGRVLRKDPYARTLDERFIRIL 177 IST+PPF QR+KQTENEIVQMFRLP+S EGNH PV GG V RK+PY+RTLDERFIRIL Sbjct: 13 ISTFPPFCQRLKQTENEIVQMFRLPNSHEGNHRSVPVTGGYVSRKEPYSRTLDERFIRIL 72 Query: 178 KIFKWGPDAEKALEVLKIKLDTRLVRE 258 KIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 73 KIFKWGPDAEKALEVLKLKVDARLVRE 99 >XP_017423149.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X2 [Vigna angularis] KOM44538.1 hypothetical protein LR48_Vigan05g214300 [Vigna angularis] BAT91587.1 hypothetical protein VIGAN_07019500 [Vigna angularis var. angularis] Length = 640 Score = 139 bits (351), Expect = 7e-37 Identities = 70/87 (80%), Positives = 78/87 (89%), Gaps = 1/87 (1%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNH-DPPVKGGRVLRKDPYARTLDERFIRIL 177 IST+PPFSQR+KQTENEIVQMFRLP+S EG+H PV G V RK+PY+RTLDERFIRIL Sbjct: 13 ISTFPPFSQRLKQTENEIVQMFRLPNSHEGDHRSVPVTGRYVSRKEPYSRTLDERFIRIL 72 Query: 178 KIFKWGPDAEKALEVLKIKLDTRLVRE 258 KIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 73 KIFKWGPDAEKALEVLKLKVDARLVRE 99 >XP_007150666.1 hypothetical protein PHAVU_005G171500g [Phaseolus vulgaris] ESW22660.1 hypothetical protein PHAVU_005G171500g [Phaseolus vulgaris] Length = 632 Score = 139 bits (350), Expect = 1e-36 Identities = 70/87 (80%), Positives = 78/87 (89%), Gaps = 1/87 (1%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNH-DPPVKGGRVLRKDPYARTLDERFIRIL 177 IST+PPFSQR+KQTENEIVQMFRLP+ E NH + PVKGG RK+PY+RTLDERFIRIL Sbjct: 5 ISTFPPFSQRLKQTENEIVQMFRLPNPHEVNHQNVPVKGGYGSRKEPYSRTLDERFIRIL 64 Query: 178 KIFKWGPDAEKALEVLKIKLDTRLVRE 258 KIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 65 KIFKWGPDAEKALEVLKLKVDARLVRE 91 >XP_003597780.1 PPR containing plant-like protein [Medicago truncatula] AES68031.1 PPR containing plant-like protein [Medicago truncatula] Length = 639 Score = 139 bits (349), Expect = 1e-36 Identities = 70/86 (81%), Positives = 76/86 (88%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYARTLDERFIRILK 180 IST PF+QR+KQTENEIV+MFRLPDS E NH P++G RVLRKDP AR LDERFIRILK Sbjct: 12 ISTSTPFTQRLKQTENEIVKMFRLPDSQEENHYVPMEGRRVLRKDPNARKLDERFIRILK 71 Query: 181 IFKWGPDAEKALEVLKIKLDTRLVRE 258 IFKWGPDAEKALEVLK+KLD RLVRE Sbjct: 72 IFKWGPDAEKALEVLKLKLDIRLVRE 97 >XP_014498628.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Vigna radiata var. radiata] XP_014498629.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Vigna radiata var. radiata] Length = 641 Score = 138 bits (347), Expect = 3e-36 Identities = 71/88 (80%), Positives = 78/88 (88%), Gaps = 2/88 (2%) Frame = +1 Query: 1 ISTWPPFSQRIKQT-ENEIVQMFRLPDSGEGNH-DPPVKGGRVLRKDPYARTLDERFIRI 174 IST+PPF QR+KQT ENEIVQMFRLP+S EGNH PV GG V RK+PY+RTLDERFIRI Sbjct: 13 ISTFPPFCQRLKQTAENEIVQMFRLPNSHEGNHRSVPVTGGYVSRKEPYSRTLDERFIRI 72 Query: 175 LKIFKWGPDAEKALEVLKIKLDTRLVRE 258 LKIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 73 LKIFKWGPDAEKALEVLKLKVDARLVRE 100 >XP_017423148.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Vigna angularis] Length = 641 Score = 135 bits (339), Expect = 3e-35 Identities = 70/88 (79%), Positives = 78/88 (88%), Gaps = 2/88 (2%) Frame = +1 Query: 1 ISTWPPFSQRIKQT-ENEIVQMFRLPDSGEGNH-DPPVKGGRVLRKDPYARTLDERFIRI 174 IST+PPFSQR+KQT ENEIVQMFRLP+S EG+H PV G V RK+PY+RTLDERFIRI Sbjct: 13 ISTFPPFSQRLKQTAENEIVQMFRLPNSHEGDHRSVPVTGRYVSRKEPYSRTLDERFIRI 72 Query: 175 LKIFKWGPDAEKALEVLKIKLDTRLVRE 258 LKIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 73 LKIFKWGPDAEKALEVLKLKVDARLVRE 100 >XP_019436424.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Lupinus angustifolius] Length = 648 Score = 133 bits (334), Expect = 2e-34 Identities = 67/87 (77%), Positives = 73/87 (83%), Gaps = 1/87 (1%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYAR-TLDERFIRIL 177 ISTWPPFSQR+KQTENEIVQMFR+P E NH+ P+ GGRVL AR LDERFIRIL Sbjct: 20 ISTWPPFSQRLKQTENEIVQMFRMPGPQEENHNFPINGGRVLSNGRNARKLLDERFIRIL 79 Query: 178 KIFKWGPDAEKALEVLKIKLDTRLVRE 258 KIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 80 KIFKWGPDAEKALEVLKLKVDARLVRE 106 >XP_015933687.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Arachis duranensis] Length = 607 Score = 126 bits (317), Expect = 3e-32 Identities = 65/86 (75%), Positives = 71/86 (82%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYARTLDERFIRILK 180 ISTWPPFSQRIKQTENEIVQMFRLP+S E P++GG R AR LDERFIRILK Sbjct: 12 ISTWPPFSQRIKQTENEIVQMFRLPNSREEKLSFPMEGGCDSRNGHNARILDERFIRILK 71 Query: 181 IFKWGPDAEKALEVLKIKLDTRLVRE 258 IFKWGPDAEKALEVLK+K++ RLVRE Sbjct: 72 IFKWGPDAEKALEVLKMKVNARLVRE 97 >XP_016167865.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g16010 [Arachis ipaensis] Length = 622 Score = 126 bits (317), Expect = 4e-32 Identities = 65/86 (75%), Positives = 71/86 (82%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYARTLDERFIRILK 180 ISTWPPFSQRIKQTENEIVQMFRLP+S E P++GG R AR LDERFIRILK Sbjct: 12 ISTWPPFSQRIKQTENEIVQMFRLPNSREEKLSFPMEGGCDSRNGHNARILDERFIRILK 71 Query: 181 IFKWGPDAEKALEVLKIKLDTRLVRE 258 IFKWGPDAEKALEVLK+K++ RLVRE Sbjct: 72 IFKWGPDAEKALEVLKMKVNARLVRE 97 >XP_002299640.2 hypothetical protein POPTR_0001s18030g [Populus trichocarpa] EEE84445.2 hypothetical protein POPTR_0001s18030g [Populus trichocarpa] Length = 641 Score = 113 bits (283), Expect = 2e-27 Identities = 58/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGN-HDPPVKGGRVLRKDPYARTLDERFIRIL 177 IST+P SQRIKQTE EIV+MF++P S + + P + + R+DP RTLDERFIRIL Sbjct: 13 ISTFPFLSQRIKQTEKEIVEMFKVPSSKDDEMQNLPTQNSKFSRRDPSVRTLDERFIRIL 72 Query: 178 KIFKWGPDAEKALEVLKIKLDTRLVRE 258 KIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 73 KIFKWGPDAEKALEVLKLKVDHRLVRE 99 >XP_018486670.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Raphanus sativus] XP_018486677.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Raphanus sativus] Length = 642 Score = 111 bits (278), Expect = 8e-27 Identities = 58/85 (68%), Positives = 68/85 (80%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYARTLDERFIRILK 180 +ST P SQR KQTE+EIVQMF LP+ E + +P K ++ RKDP RTLDERFIRILK Sbjct: 15 VSTLPHLSQRFKQTESEIVQMFSLPNPEEESENPREKW-KLSRKDPSVRTLDERFIRILK 73 Query: 181 IFKWGPDAEKALEVLKIKLDTRLVR 255 IFKWGPDAEKALEVLK+++D RLVR Sbjct: 74 IFKWGPDAEKALEVLKLRVDHRLVR 98 >XP_011002687.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Populus euphratica] Length = 656 Score = 111 bits (277), Expect = 1e-26 Identities = 57/87 (65%), Positives = 68/87 (78%), Gaps = 1/87 (1%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGN-HDPPVKGGRVLRKDPYARTLDERFIRIL 177 IST+P QRIKQTE EIV+MF++P S + + P + + R+DP RTLDERFIRIL Sbjct: 28 ISTFPFLFQRIKQTEKEIVEMFKVPSSKDDEMQNLPTQNSKFSRRDPSVRTLDERFIRIL 87 Query: 178 KIFKWGPDAEKALEVLKIKLDTRLVRE 258 KIFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 88 KIFKWGPDAEKALEVLKLKVDHRLVRE 114 >OMO54124.1 hypothetical protein CCACVL1_28035 [Corchorus capsularis] Length = 517 Score = 109 bits (273), Expect = 3e-26 Identities = 61/86 (70%), Positives = 66/86 (76%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYARTLDERFIRILK 180 IST P QRIKQTENEIV MFRLP S D V ++ RK+ ARTLDERFIRILK Sbjct: 12 ISTLPYLCQRIKQTENEIVGMFRLPSSNNELQDLGVNR-KLHRKNSSARTLDERFIRILK 70 Query: 181 IFKWGPDAEKALEVLKIKLDTRLVRE 258 IFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 71 IFKWGPDAEKALEVLKLKVDQRLVRE 96 >XP_018486671.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X2 [Raphanus sativus] XP_018486678.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X2 [Raphanus sativus] Length = 641 Score = 109 bits (273), Expect = 4e-26 Identities = 57/85 (67%), Positives = 67/85 (78%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYARTLDERFIRILK 180 +ST P SQR KQTE+EIVQMF LP+ E + P + ++ RKDP RTLDERFIRILK Sbjct: 15 VSTLPHLSQRFKQTESEIVQMFSLPNPEESEN--PREKWKLSRKDPSVRTLDERFIRILK 72 Query: 181 IFKWGPDAEKALEVLKIKLDTRLVR 255 IFKWGPDAEKALEVLK+++D RLVR Sbjct: 73 IFKWGPDAEKALEVLKLRVDHRLVR 97 >XP_012073332.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Jatropha curcas] KDP37204.1 hypothetical protein JCGZ_06260 [Jatropha curcas] Length = 641 Score = 109 bits (272), Expect = 5e-26 Identities = 58/86 (67%), Positives = 65/86 (75%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRVLRKDPYARTLDERFIRILK 180 IST P +RIKQTENEIVQMFRLP + + P+ + R DP R LDERFIRILK Sbjct: 15 ISTLPHLCERIKQTENEIVQMFRLPSRNDEMQNLPMNR-KFSRNDPSIRKLDERFIRILK 73 Query: 181 IFKWGPDAEKALEVLKIKLDTRLVRE 258 IFKWGPDAEKALEVLK+K+D RLVRE Sbjct: 74 IFKWGPDAEKALEVLKLKVDHRLVRE 99 >XP_011072331.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Sesamum indicum] XP_011072332.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Sesamum indicum] XP_011072333.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Sesamum indicum] Length = 288 Score = 105 bits (263), Expect = 6e-26 Identities = 60/87 (68%), Positives = 65/87 (74%), Gaps = 1/87 (1%) Frame = +1 Query: 1 ISTWPPFSQRIKQTENEIVQMFRLPDSGEGNHDPPVKGGRV-LRKDPYARTLDERFIRIL 177 IST +R+KQTENEIVQMFRL G D P G R +RK+ AR LDERFIRIL Sbjct: 18 ISTCSCLFERVKQTENEIVQMFRL---GSPKDDTPYFGNRSPIRKNSSARALDERFIRIL 74 Query: 178 KIFKWGPDAEKALEVLKIKLDTRLVRE 258 KIFKWGPDAEKALEVLK+KLD RLVRE Sbjct: 75 KIFKWGPDAEKALEVLKLKLDHRLVRE 101