BLASTX nr result
ID: Glycyrrhiza28_contig00037653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037653 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024583458.1 hypothetical protein [Bradyrhizobium elkanii] KIU... 122 4e-34 WP_029879736.1 hypothetical protein [Bradyrhizobium sp. OHSU_III... 112 1e-30 SER39013.1 GIY-YIG catalytic domain-containing protein [Lewinell... 55 1e-06 >WP_024583458.1 hypothetical protein [Bradyrhizobium elkanii] KIU42985.1 hypothetical protein QU41_33025 [Bradyrhizobium elkanii] Length = 85 Score = 122 bits (305), Expect = 4e-34 Identities = 63/69 (91%), Positives = 64/69 (92%), Gaps = 1/69 (1%) Frame = -1 Query: 219 AHGLTMDDT-ARTIGYRMKPWTTDEERKILRLRDTGKTPREISLLLGRSQAAIEARFRKV 43 +HGLTMDDT RTIGYRMKPWT DEERKIL LRDTGKTPREISLLLGRSQAAIEARFRKV Sbjct: 17 SHGLTMDDTDTRTIGYRMKPWTADEERKILLLRDTGKTPREISLLLGRSQAAIEARFRKV 76 Query: 42 RREQSRSTS 16 R EQSRSTS Sbjct: 77 RLEQSRSTS 85 >WP_029879736.1 hypothetical protein [Bradyrhizobium sp. OHSU_III] OCX31121.1 hypothetical protein QU42_10225 [Bradyrhizobium sp. UASWS1016] Length = 64 Score = 112 bits (281), Expect = 1e-30 Identities = 59/64 (92%), Positives = 59/64 (92%), Gaps = 1/64 (1%) Frame = -1 Query: 204 MDDT-ARTIGYRMKPWTTDEERKILRLRDTGKTPREISLLLGRSQAAIEARFRKVRREQS 28 MDDT RTIGYRMKPWT DEERKIL LRDTGKTPREISLLLGRSQAAIEARFRKVR EQS Sbjct: 1 MDDTDTRTIGYRMKPWTADEERKILLLRDTGKTPREISLLLGRSQAAIEARFRKVRLEQS 60 Query: 27 RSTS 16 RSTS Sbjct: 61 RSTS 64 >SER39013.1 GIY-YIG catalytic domain-containing protein [Lewinella agarilytica] Length = 217 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = -1 Query: 168 KPWTTDEERKILRLRDTGKTPREISLLLGRSQAAIEARFRKVRREQSRST 19 +PW +EERKI+ L + GKT +EI ++GR++ AI +R RK+R RS+ Sbjct: 168 RPWNEEEERKIIELSNQGKTAKEIREIVGRNKGAISSRLRKIRERSERSS 217