BLASTX nr result
ID: Glycyrrhiza28_contig00037203
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00037203 (517 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004489347.1 PREDICTED: alpha-mannosidase 2 [Cicer arietinum] 79 8e-14 GAU37095.1 hypothetical protein TSUD_278820 [Trifolium subterran... 74 4e-12 XP_003607055.2 alpha-mannosidase 2x-like protein [Medicago trunc... 72 1e-11 XP_003618381.2 alpha-mannosidase 2x-like protein [Medicago trunc... 72 1e-11 XP_019427730.1 PREDICTED: alpha-mannosidase 2-like [Lupinus angu... 70 9e-11 XP_019442599.1 PREDICTED: alpha-mannosidase 2-like [Lupinus angu... 70 9e-11 XP_016180155.1 PREDICTED: alpha-mannosidase 2 [Arachis ipaensis] 67 8e-10 XP_015946002.1 PREDICTED: alpha-mannosidase 2 [Arachis duranensis] 67 8e-10 XP_007151154.1 hypothetical protein PHAVU_004G022500g [Phaseolus... 67 1e-09 KHN34168.1 Alpha-mannosidase 2x [Glycine soja] 65 2e-09 XP_003554861.1 PREDICTED: alpha-mannosidase 2-like isoform X1 [G... 65 3e-09 KHN13269.1 Alpha-mannosidase 2x [Glycine soja] 64 7e-09 XP_003543837.1 PREDICTED: alpha-mannosidase 2-like isoform X1 [G... 64 7e-09 XP_016561481.1 PREDICTED: alpha-mannosidase 2 [Capsicum annuum] 62 4e-08 CBI35021.3 unnamed protein product, partial [Vitis vinifera] 61 8e-08 XP_002276468.1 PREDICTED: alpha-mannosidase 2 [Vitis vinifera] X... 61 8e-08 XP_014512139.1 PREDICTED: alpha-mannosidase 2 [Vigna radiata var... 61 8e-08 XP_017439801.1 PREDICTED: alpha-mannosidase 2 [Vigna angularis] ... 61 8e-08 XP_015066522.1 PREDICTED: alpha-mannosidase 2 [Solanum pennellii] 59 7e-07 XP_006338514.1 PREDICTED: alpha-mannosidase 2 [Solanum tuberosum] 59 7e-07 >XP_004489347.1 PREDICTED: alpha-mannosidase 2 [Cicer arietinum] Length = 1162 Score = 78.6 bits (192), Expect = 8e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRRGG NW+ +S LPSSNPKSK+PRKGRRRTLLKDFIFSNFF Sbjct: 1 MAFSSRRGG-NWA-QSILPSSNPKSKIPRKGRRRTLLKDFIFSNFF 44 >GAU37095.1 hypothetical protein TSUD_278820 [Trifolium subterraneum] Length = 1159 Score = 73.6 bits (179), Expect = 4e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 343 SSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 SS R GGNW+ +S LPSSNPKSK+PRKG+RRTLLKDFIFSNFF Sbjct: 3 SSSRRGGNWA-QSVLPSSNPKSKIPRKGKRRTLLKDFIFSNFF 44 >XP_003607055.2 alpha-mannosidase 2x-like protein [Medicago truncatula] AES89252.2 alpha-mannosidase 2x-like protein [Medicago truncatula] Length = 1137 Score = 72.0 bits (175), Expect = 1e-11 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRRGG NW+ +S LPSSNPKSK PRK +RRTL+KDFIFSNFF Sbjct: 1 MAFSSRRGG-NWA-QSILPSSNPKSKQPRKSKRRTLVKDFIFSNFF 44 >XP_003618381.2 alpha-mannosidase 2x-like protein [Medicago truncatula] AES74599.2 alpha-mannosidase 2x-like protein [Medicago truncatula] Length = 1150 Score = 72.0 bits (175), Expect = 1e-11 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRRGG NW+ +S LPSSNPKSK PRK +RRTL+KDFIFSNFF Sbjct: 1 MAFSSRRGG-NWA-QSILPSSNPKSKQPRKSKRRTLVKDFIFSNFF 44 >XP_019427730.1 PREDICTED: alpha-mannosidase 2-like [Lupinus angustifolius] Length = 1155 Score = 69.7 bits (169), Expect = 9e-11 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 328 FMMAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 F + + R GGG+WS +S LPS+NPKSK+PRK RRRT+LKDFIFSNFF Sbjct: 3 FSIGSTRRGGGGSWS-QSILPSTNPKSKIPRKQRRRTMLKDFIFSNFF 49 >XP_019442599.1 PREDICTED: alpha-mannosidase 2-like [Lupinus angustifolius] XP_019442600.1 PREDICTED: alpha-mannosidase 2-like [Lupinus angustifolius] XP_019442601.1 PREDICTED: alpha-mannosidase 2-like [Lupinus angustifolius] XP_019442603.1 PREDICTED: alpha-mannosidase 2-like [Lupinus angustifolius] XP_019442604.1 PREDICTED: alpha-mannosidase 2-like [Lupinus angustifolius] XP_019442606.1 PREDICTED: alpha-mannosidase 2-like [Lupinus angustifolius] OIW12419.1 hypothetical protein TanjilG_04168 [Lupinus angustifolius] OIW12421.1 hypothetical protein TanjilG_04170 [Lupinus angustifolius] Length = 1161 Score = 69.7 bits (169), Expect = 9e-11 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +1 Query: 328 FMMAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 F + + R GGG+WS +S LPS+NPKSKVPRK RRRT+LKDFIFSNFF Sbjct: 3 FSIGSTRRGGGGSWS-QSILPSTNPKSKVPRKQRRRTVLKDFIFSNFF 49 >XP_016180155.1 PREDICTED: alpha-mannosidase 2 [Arachis ipaensis] Length = 1156 Score = 67.0 bits (162), Expect = 8e-10 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRR G +W +S LPSSNPKSKVPRK RRR LKDFIFSNFF Sbjct: 1 MAFSSRRSG-SWG-QSILPSSNPKSKVPRKQRRRAQLKDFIFSNFF 44 >XP_015946002.1 PREDICTED: alpha-mannosidase 2 [Arachis duranensis] Length = 1156 Score = 67.0 bits (162), Expect = 8e-10 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRR G +W +S LPSSNPKSKVPRK RRR LKDFIFSNFF Sbjct: 1 MAFSSRRSG-SWG-QSILPSSNPKSKVPRKQRRRAQLKDFIFSNFF 44 >XP_007151154.1 hypothetical protein PHAVU_004G022500g [Phaseolus vulgaris] ESW23148.1 hypothetical protein PHAVU_004G022500g [Phaseolus vulgaris] Length = 1152 Score = 66.6 bits (161), Expect = 1e-09 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +1 Query: 343 SSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFFA 474 SS R G W+ S LPSSNPKSK PRKGRRRT+LKDFIFSNFF+ Sbjct: 3 SSSRRGAAWA-SSILPSSNPKSKAPRKGRRRTVLKDFIFSNFFS 45 >KHN34168.1 Alpha-mannosidase 2x [Glycine soja] Length = 605 Score = 65.5 bits (158), Expect = 2e-09 Identities = 35/48 (72%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNP-KSKVPRKGRRRTLLKDFIFSNFFA 474 M FSS R G +WS S LPSSNP KSK PRKGR+R L+KDFIFSNFFA Sbjct: 1 MPFSSSRRGTSWS-SSILPSSNPHKSKAPRKGRKRALVKDFIFSNFFA 47 >XP_003554861.1 PREDICTED: alpha-mannosidase 2-like isoform X1 [Glycine max] KRG93432.1 hypothetical protein GLYMA_19G015900 [Glycine max] Length = 1155 Score = 65.5 bits (158), Expect = 3e-09 Identities = 35/48 (72%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNP-KSKVPRKGRRRTLLKDFIFSNFFA 474 M FSS R G +WS S LPSSNP KSK PRKGR+R L+KDFIFSNFFA Sbjct: 1 MPFSSSRRGTSWS-SSILPSSNPHKSKAPRKGRKRALVKDFIFSNFFA 47 >KHN13269.1 Alpha-mannosidase 2x [Glycine soja] Length = 1132 Score = 64.3 bits (155), Expect = 7e-09 Identities = 34/48 (70%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNP-KSKVPRKGRRRTLLKDFIFSNFFA 474 M FSS R G +W+ S LPSSNP KSK PRKGR+R L+KDFIFSNFFA Sbjct: 1 MPFSSSRRGTSWA-SSILPSSNPPKSKAPRKGRKRALVKDFIFSNFFA 47 >XP_003543837.1 PREDICTED: alpha-mannosidase 2-like isoform X1 [Glycine max] KRH18566.1 hypothetical protein GLYMA_13G068100 [Glycine max] Length = 1155 Score = 64.3 bits (155), Expect = 7e-09 Identities = 34/48 (70%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNP-KSKVPRKGRRRTLLKDFIFSNFFA 474 M FSS R G +W+ S LPSSNP KSK PRKGR+R L+KDFIFSNFFA Sbjct: 1 MPFSSSRRGTSWA-SSILPSSNPPKSKAPRKGRKRALVKDFIFSNFFA 47 >XP_016561481.1 PREDICTED: alpha-mannosidase 2 [Capsicum annuum] Length = 1152 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRRGG W+ S LP++ P + PRK RRRT ++DFIFSNFF Sbjct: 1 MAFSSRRGGAGWA-HSLLPTTKPSPRQPRKSRRRTAVRDFIFSNFF 45 >CBI35021.3 unnamed protein product, partial [Vitis vinifera] Length = 1056 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRRGG W+ S LPSSN KSK+PRK R+RT LKDF +NFF Sbjct: 1 MAFSSRRGG--WA-HSLLPSSNSKSKLPRKARKRTFLKDFFLANFF 43 >XP_002276468.1 PREDICTED: alpha-mannosidase 2 [Vitis vinifera] XP_010661000.1 PREDICTED: alpha-mannosidase 2 [Vitis vinifera] XP_019080600.1 PREDICTED: alpha-mannosidase 2 [Vitis vinifera] Length = 1149 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRRGG W+ S LPSSN KSK+PRK R+RT LKDF +NFF Sbjct: 1 MAFSSRRGG--WA-HSLLPSSNSKSKLPRKARKRTFLKDFFLANFF 43 >XP_014512139.1 PREDICTED: alpha-mannosidase 2 [Vigna radiata var. radiata] Length = 1151 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/46 (73%), Positives = 35/46 (76%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 M FSSRR W+ S LPSSNPKSKVPRKGRRR L DFIFSNFF Sbjct: 1 MPFSSRRTP--WA-SSILPSSNPKSKVPRKGRRRAWLTDFIFSNFF 43 >XP_017439801.1 PREDICTED: alpha-mannosidase 2 [Vigna angularis] KOM56770.1 hypothetical protein LR48_Vigan10g266200 [Vigna angularis] BAU01117.1 hypothetical protein VIGAN_11027800 [Vigna angularis var. angularis] Length = 1151 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/46 (73%), Positives = 35/46 (76%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 M FSSRR W+ S LPSSNPKSKVPRKGRRR L DFIFSNFF Sbjct: 1 MPFSSRRTP--WA-SSILPSSNPKSKVPRKGRRRAWLTDFIFSNFF 43 >XP_015066522.1 PREDICTED: alpha-mannosidase 2 [Solanum pennellii] Length = 1151 Score = 58.5 bits (140), Expect = 7e-07 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRRGG W+ S LP+S S+ PRK RRRT L+DF SNFF Sbjct: 1 MAFSSRRGGTGWA-HSLLPTSKSSSRQPRKSRRRTALRDFFLSNFF 45 >XP_006338514.1 PREDICTED: alpha-mannosidase 2 [Solanum tuberosum] Length = 1151 Score = 58.5 bits (140), Expect = 7e-07 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 334 MAFSSRRGGGNWSPKSTLPSSNPKSKVPRKGRRRTLLKDFIFSNFF 471 MAFSSRRGG W+ S LP+S S+ PRK RRRT L+DF SNFF Sbjct: 1 MAFSSRRGGTGWA-HSLLPTSKSSSRQPRKSRRRTALRDFFLSNFF 45