BLASTX nr result
ID: Glycyrrhiza28_contig00035424
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00035424 (426 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017418587.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 3e-11 XP_014514004.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 8e-10 XP_007140367.1 hypothetical protein PHAVU_008G105900g [Phaseolus... 63 7e-09 >XP_017418587.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418588.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418589.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418590.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418591.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418593.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418594.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418595.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418596.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418597.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418598.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] XP_017418599.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna angularis] KOM37537.1 hypothetical protein LR48_Vigan03g091900 [Vigna angularis] BAT84140.1 hypothetical protein VIGAN_04142100 [Vigna angularis var. angularis] Length = 718 Score = 70.1 bits (170), Expect = 3e-11 Identities = 37/67 (55%), Positives = 43/67 (64%) Frame = -2 Query: 203 MIPKRLLNPPRSTFFIPTNVCPFHVXXXXXXXXXXXSLTEAVSLFHRAVEDPDSVPSVPA 24 MIPKRLLNPP S T V FHV SL++AVSLFHR + DP+++PS PA Sbjct: 1 MIPKRLLNPPLSQTSSSTTVNGFHVSASASISHTPHSLSDAVSLFHRTINDPNALPSEPA 60 Query: 23 CNSLIHN 3 CNSLI N Sbjct: 61 CNSLIGN 67 >XP_014514004.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna radiata var. radiata] XP_014514005.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna radiata var. radiata] XP_014514006.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna radiata var. radiata] XP_014514007.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna radiata var. radiata] XP_014514008.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna radiata var. radiata] XP_014514009.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna radiata var. radiata] XP_014514010.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Vigna radiata var. radiata] Length = 718 Score = 65.9 bits (159), Expect = 8e-10 Identities = 37/67 (55%), Positives = 41/67 (61%) Frame = -2 Query: 203 MIPKRLLNPPRSTFFIPTNVCPFHVXXXXXXXXXXXSLTEAVSLFHRAVEDPDSVPSVPA 24 MIPKRLLNPP S T V F V SL++AVSLFHR + DP+S PS PA Sbjct: 1 MIPKRLLNPPLSPTSSFTTVNGFRVSASASISHTPHSLSDAVSLFHRTINDPNSPPSEPA 60 Query: 23 CNSLIHN 3 CNSLI N Sbjct: 61 CNSLIGN 67 >XP_007140367.1 hypothetical protein PHAVU_008G105900g [Phaseolus vulgaris] XP_007140368.1 hypothetical protein PHAVU_008G105900g [Phaseolus vulgaris] XP_007140369.1 hypothetical protein PHAVU_008G105900g [Phaseolus vulgaris] ESW12361.1 hypothetical protein PHAVU_008G105900g [Phaseolus vulgaris] ESW12362.1 hypothetical protein PHAVU_008G105900g [Phaseolus vulgaris] ESW12363.1 hypothetical protein PHAVU_008G105900g [Phaseolus vulgaris] Length = 717 Score = 63.2 bits (152), Expect = 7e-09 Identities = 37/71 (52%), Positives = 43/71 (60%), Gaps = 4/71 (5%) Frame = -2 Query: 203 MIPKRLLNPPRSTFFIP----TNVCPFHVXXXXXXXXXXXSLTEAVSLFHRAVEDPDSVP 36 MIPKRLLNPP +P T V PF+V SL++AVSLFHR + DP+S P Sbjct: 1 MIPKRLLNPP-----LPPPSSTTVNPFNVSASASISHTPHSLSDAVSLFHRTIHDPNSPP 55 Query: 35 SVPACNSLIHN 3 S P CNSLI N Sbjct: 56 SEPECNSLIDN 66