BLASTX nr result
ID: Glycyrrhiza28_contig00035173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00035173 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP75303.1 Thioredoxin domain-containing protein 9 isogeny [Caja... 74 9e-14 XP_007143085.1 hypothetical protein PHAVU_007G042300g [Phaseolus... 74 9e-14 KRG91067.1 hypothetical protein GLYMA_20G131000 [Glycine max] 72 1e-13 KJB32293.1 hypothetical protein B456_005G233900 [Gossypium raimo... 72 1e-13 XP_006412245.1 hypothetical protein EUTSA_v10026241mg [Eutrema s... 72 2e-13 BAT93924.1 hypothetical protein VIGAN_08047700 [Vigna angularis ... 72 3e-13 XP_014512205.1 PREDICTED: thioredoxin domain-containing protein ... 72 3e-13 XP_017413583.1 PREDICTED: thioredoxin domain-containing protein ... 72 3e-13 XP_010271635.1 PREDICTED: thioredoxin domain-containing protein ... 72 3e-13 XP_016691636.1 PREDICTED: thioredoxin domain-containing protein ... 72 3e-13 XP_016175989.1 PREDICTED: thioredoxin domain-containing protein ... 72 3e-13 XP_016172016.1 PREDICTED: thioredoxin domain-containing protein ... 72 3e-13 XP_015942041.1 PREDICTED: thioredoxin domain-containing protein ... 72 3e-13 XP_012480179.1 PREDICTED: thioredoxin domain-containing protein ... 72 3e-13 XP_019170200.1 PREDICTED: thioredoxin domain-containing protein ... 72 3e-13 XP_007042575.2 PREDICTED: thioredoxin domain-containing protein ... 72 4e-13 EOX98406.1 Thioredoxin domain-containing protein 9 [Theobroma ca... 72 4e-13 XP_003555977.1 PREDICTED: thioredoxin domain-containing protein ... 72 4e-13 XP_010277143.1 PREDICTED: thioredoxin domain-containing protein ... 70 4e-13 XP_006598029.1 PREDICTED: thioredoxin domain-containing protein ... 70 5e-13 >KYP75303.1 Thioredoxin domain-containing protein 9 isogeny [Cajanus cajan] Length = 213 Score = 73.6 bits (179), Expect = 9e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIPSEKDFFSVVKASERVVCHFYRENWPCKV+ Sbjct: 70 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVM 102 >XP_007143085.1 hypothetical protein PHAVU_007G042300g [Phaseolus vulgaris] ESW15079.1 hypothetical protein PHAVU_007G042300g [Phaseolus vulgaris] Length = 213 Score = 73.6 bits (179), Expect = 9e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIPSEKDFFSVVKASERVVCHFYRENWPCKV+ Sbjct: 70 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVM 102 >KRG91067.1 hypothetical protein GLYMA_20G131000 [Glycine max] Length = 155 Score = 72.0 bits (175), Expect = 1e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIPSEKDFFSVVKASERVVCHF+RENWPCKV+ Sbjct: 70 SEIPSEKDFFSVVKASERVVCHFFRENWPCKVM 102 >KJB32293.1 hypothetical protein B456_005G233900 [Gossypium raimondii] Length = 163 Score = 72.0 bits (175), Expect = 1e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIP+EKDFFS+VKASERVVCHFYRENWPCKV+ Sbjct: 70 SEIPAEKDFFSIVKASERVVCHFYRENWPCKVM 102 >XP_006412245.1 hypothetical protein EUTSA_v10026241mg [Eutrema salsugineum] ESQ53698.1 hypothetical protein EUTSA_v10026241mg [Eutrema salsugineum] Length = 210 Score = 72.4 bits (176), Expect = 2e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIPSEKDFF+VVKASERVVCHFYRENWPCKV+ Sbjct: 69 SEIPSEKDFFAVVKASERVVCHFYRENWPCKVM 101 >BAT93924.1 hypothetical protein VIGAN_08047700 [Vigna angularis var. angularis] Length = 213 Score = 72.4 bits (176), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 +EIPSEKDFFSVVKASERVVCHFYRENWPCKV+ Sbjct: 70 TEIPSEKDFFSVVKASERVVCHFYRENWPCKVM 102 >XP_014512205.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Vigna radiata var. radiata] Length = 213 Score = 72.4 bits (176), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 +EIPSEKDFFSVVKASERVVCHFYRENWPCKV+ Sbjct: 70 TEIPSEKDFFSVVKASERVVCHFYRENWPCKVM 102 >XP_017413583.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Vigna angularis] KOM36239.1 hypothetical protein LR48_Vigan02g238900 [Vigna angularis] Length = 213 Score = 72.4 bits (176), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 +EIPSEKDFFSVVKASERVVCHFYRENWPCKV+ Sbjct: 70 TEIPSEKDFFSVVKASERVVCHFYRENWPCKVM 102 >XP_010271635.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Nelumbo nucifera] Length = 213 Score = 72.4 bits (176), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIPSEKDFFSVVKASERVVCHFYR+NWPCKV+ Sbjct: 70 SEIPSEKDFFSVVKASERVVCHFYRDNWPCKVM 102 >XP_016691636.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Gossypium hirsutum] Length = 210 Score = 72.0 bits (175), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIP+EKDFFS+VKASERVVCHFYRENWPCKV+ Sbjct: 70 SEIPAEKDFFSIVKASERVVCHFYRENWPCKVM 102 >XP_016175989.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Arachis ipaensis] Length = 210 Score = 72.0 bits (175), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 +EIPSEKDFFSVVKASERVVCHFYRENWPCKV+ Sbjct: 70 TEIPSEKDFFSVVKASERVVCHFYRENWPCKVV 102 >XP_016172016.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Arachis ipaensis] Length = 210 Score = 72.0 bits (175), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 +EIPSEKDFFSVVKASERVVCHFYRENWPCKV+ Sbjct: 70 TEIPSEKDFFSVVKASERVVCHFYRENWPCKVV 102 >XP_015942041.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Arachis duranensis] Length = 210 Score = 72.0 bits (175), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 +EIPSEKDFFSVVKASERVVCHFYRENWPCKV+ Sbjct: 70 TEIPSEKDFFSVVKASERVVCHFYRENWPCKVV 102 >XP_012480179.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Gossypium raimondii] KJB32292.1 hypothetical protein B456_005G233900 [Gossypium raimondii] KJB32294.1 hypothetical protein B456_005G233900 [Gossypium raimondii] Length = 210 Score = 72.0 bits (175), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIP+EKDFFS+VKASERVVCHFYRENWPCKV+ Sbjct: 70 SEIPAEKDFFSIVKASERVVCHFYRENWPCKVM 102 >XP_019170200.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Ipomoea nil] Length = 211 Score = 72.0 bits (175), Expect = 3e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIPSEKDFFSVVKASERVVCHFYR+NWPCKV+ Sbjct: 69 SEIPSEKDFFSVVKASERVVCHFYRDNWPCKVV 101 >XP_007042575.2 PREDICTED: thioredoxin domain-containing protein 9 homolog [Theobroma cacao] Length = 213 Score = 72.0 bits (175), Expect = 4e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIP+EKDFFS+VKASERVVCHFYRENWPCKV+ Sbjct: 70 SEIPAEKDFFSIVKASERVVCHFYRENWPCKVM 102 >EOX98406.1 Thioredoxin domain-containing protein 9 [Theobroma cacao] Length = 213 Score = 72.0 bits (175), Expect = 4e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIP+EKDFFS+VKASERVVCHFYRENWPCKV+ Sbjct: 70 SEIPAEKDFFSIVKASERVVCHFYRENWPCKVM 102 >XP_003555977.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Glycine max] KHN42339.1 Thioredoxin domain-containing protein 9 like [Glycine soja] KRG91066.1 hypothetical protein GLYMA_20G131000 [Glycine max] Length = 213 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIPSEKDFFSVVKASERVVCHF+RENWPCKV+ Sbjct: 70 SEIPSEKDFFSVVKASERVVCHFFRENWPCKVM 102 >XP_010277143.1 PREDICTED: thioredoxin domain-containing protein 9 homolog isoform X2 [Nelumbo nucifera] Length = 116 Score = 69.7 bits (169), Expect = 4e-13 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIPSEKDFF+VVKASERVVCHFYR+NWPCK L Sbjct: 70 SEIPSEKDFFAVVKASERVVCHFYRDNWPCKKL 102 >XP_006598029.1 PREDICTED: thioredoxin domain-containing protein 9 homolog [Glycine max] KRH13153.1 hypothetical protein GLYMA_15G219600 [Glycine max] KRH13154.1 hypothetical protein GLYMA_15G219600 [Glycine max] Length = 154 Score = 70.5 bits (171), Expect = 5e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 335 SEIPSEKDFFSVVKASERVVCHFYRENWPCKVL 237 SEIPS+KDFFSVVKASERVVCHF+RENWPCKV+ Sbjct: 70 SEIPSKKDFFSVVKASERVVCHFFRENWPCKVM 102