BLASTX nr result
ID: Glycyrrhiza28_contig00035056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00035056 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_056249963.1 cobyric acid synthase CobQ [Methylobacterium sp. ... 144 2e-39 SFK64875.1 adenosylcobyric acid synthase (glutamine-hydrolysing)... 135 4e-36 WP_012456952.1 cobyric acid synthase CobQ [Methylobacterium popu... 112 1e-27 WP_063986943.1 cobyric acid synthase CobQ [Methylobacterium popu... 112 1e-27 WP_056198105.1 cobyric acid synthase CobQ [Methylobacterium sp. ... 112 3e-27 BAU93840.1 cobyric acid synthase CobQ [Methylobacterium populi] 111 3e-27 WP_041929133.1 cobyric acid synthase CobQ [Methylobacterium exto... 111 5e-27 ACK85952.1 cobyric acid synthase CobQ [Methylobacterium extorque... 111 5e-27 WP_076641754.1 cobyric acid synthase CobQ [Methylobacterium exto... 110 9e-27 OHV17326.1 cobyric acid synthase CobQ [Methylobacterium extorquens] 110 9e-27 WP_056505953.1 cobyric acid synthase CobQ [Methylobacterium sp. ... 110 9e-27 WP_056464195.1 cobyric acid synthase CobQ [Methylobacterium sp. ... 110 9e-27 WP_042509060.1 MULTISPECIES: cobyric acid synthase CobQ [Methylo... 110 9e-27 WP_003600777.1 cobyric acid synthase CobQ [Methylobacterium exto... 110 9e-27 ABY33091.1 cobyric acid synthase CobQ [Methylobacterium extorque... 110 1e-26 CAB40734.1 CobQ protein, partial [Methylobacterium extorquens CM4] 109 1e-26 WP_041929462.1 cobyric acid synthase CobQ [Methylobacterium exto... 109 2e-26 ACK86437.1 cobyric acid synthase CobQ (plasmid) [Methylobacteriu... 109 2e-26 WP_017483359.1 cobyric acid synthase CobQ [Methylobacterium sp. ... 109 2e-26 WP_056091295.1 cobyric acid synthase CobQ [Methylobacterium sp. ... 108 3e-26 >WP_056249963.1 cobyric acid synthase CobQ [Methylobacterium sp. Leaf456] KQT45659.1 cobalamin biosynthesis protein CobQ [Methylobacterium sp. Leaf456] Length = 488 Score = 144 bits (364), Expect = 2e-39 Identities = 69/76 (90%), Positives = 72/76 (94%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVSADGL++GTYVHGLFSDDRQRAAWLARLGAPAS YEAGIETVLDRFADHLETHLDC Sbjct: 413 AVSADGLVSGTYVHGLFSDDRQRAAWLARLGAPASSESYEAGIETVLDRFADHLETHLDC 472 Query: 59 DRLLSLAEPYRSPGTV 12 DRLL+LAEPYR PGTV Sbjct: 473 DRLLALAEPYRRPGTV 488 >SFK64875.1 adenosylcobyric acid synthase (glutamine-hydrolysing) [Methylobacterium salsuginis] Length = 489 Score = 135 bits (341), Expect = 4e-36 Identities = 66/77 (85%), Positives = 71/77 (92%), Gaps = 1/77 (1%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVSADGL++GTYVHGLF+DDRQRAAWLAR+GAP S RYEAGIE VLDRFADHLETHLDC Sbjct: 413 AVSADGLVSGTYVHGLFADDRQRAAWLARIGAPPSSERYEAGIEAVLDRFADHLETHLDC 472 Query: 59 DRLLSLAEPYR-SPGTV 12 DRLL+LA PYR SPGTV Sbjct: 473 DRLLALAGPYRLSPGTV 489 >WP_012456952.1 cobyric acid synthase CobQ [Methylobacterium populi] B1Z9X0.1 RecName: Full=Cobyric acid synthase ACB83356.1 cobyric acid synthase CobQ [Methylobacterium populi BJ001] Length = 488 Score = 112 bits (281), Expect = 1e-27 Identities = 54/69 (78%), Positives = 57/69 (82%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVSADGL+AGTYVHGLF++DRQRAAWLARLGA YEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSADGLVAGTYVHGLFANDRQRAAWLARLGAAPGLTNYEAGIEAVLDRFADHLEAHLDC 478 Query: 59 DRLLSLAEP 33 D LL L P Sbjct: 479 DGLLRLCRP 487 >WP_063986943.1 cobyric acid synthase CobQ [Methylobacterium populi] OAH38312.1 cobalamin biosynthesis protein CobQ [Methylobacterium populi] Length = 488 Score = 112 bits (281), Expect = 1e-27 Identities = 54/69 (78%), Positives = 57/69 (82%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVSADGL+AGTYVHGLF++DRQRAAWLARLGA YEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSADGLVAGTYVHGLFANDRQRAAWLARLGAAPGLTNYEAGIEAVLDRFADHLEAHLDC 478 Query: 59 DRLLSLAEP 33 D LL L P Sbjct: 479 DGLLRLCRP 487 >WP_056198105.1 cobyric acid synthase CobQ [Methylobacterium sp. Leaf123] KQQ23768.1 cobalamin biosynthesis protein CobQ [Methylobacterium sp. Leaf123] Length = 485 Score = 112 bits (279), Expect = 3e-27 Identities = 54/67 (80%), Positives = 56/67 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 478 Query: 59 DRLLSLA 39 D LL LA Sbjct: 479 DGLLRLA 485 >BAU93840.1 cobyric acid synthase CobQ [Methylobacterium populi] Length = 485 Score = 111 bits (278), Expect = 3e-27 Identities = 54/66 (81%), Positives = 56/66 (84%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+AGTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSRDGLVAGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 478 Query: 59 DRLLSL 42 D LL L Sbjct: 479 DGLLRL 484 >WP_041929133.1 cobyric acid synthase CobQ [Methylobacterium extorquens] Length = 485 Score = 111 bits (277), Expect = 5e-27 Identities = 53/66 (80%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 478 Query: 59 DRLLSL 42 D LL L Sbjct: 479 DELLRL 484 >ACK85952.1 cobyric acid synthase CobQ [Methylobacterium extorquens CM4] Length = 500 Score = 111 bits (277), Expect = 5e-27 Identities = 53/66 (80%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 434 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 493 Query: 59 DRLLSL 42 D LL L Sbjct: 494 DELLRL 499 >WP_076641754.1 cobyric acid synthase CobQ [Methylobacterium extorquens] APX84725.1 cobyric acid synthase CobQ [Methylobacterium extorquens] Length = 485 Score = 110 bits (275), Expect = 9e-27 Identities = 53/66 (80%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 478 Query: 59 DRLLSL 42 D LL L Sbjct: 479 DGLLRL 484 >OHV17326.1 cobyric acid synthase CobQ [Methylobacterium extorquens] Length = 485 Score = 110 bits (275), Expect = 9e-27 Identities = 53/66 (80%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 478 Query: 59 DRLLSL 42 D LL L Sbjct: 479 DGLLRL 484 >WP_056505953.1 cobyric acid synthase CobQ [Methylobacterium sp. Leaf121] KQP99763.1 cobalamin biosynthesis protein CobQ [Methylobacterium sp. Leaf121] Length = 485 Score = 110 bits (275), Expect = 9e-27 Identities = 53/66 (80%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 478 Query: 59 DRLLSL 42 D LL L Sbjct: 479 DGLLRL 484 >WP_056464195.1 cobyric acid synthase CobQ [Methylobacterium sp. Leaf90] KQO78187.1 cobalamin biosynthesis protein CobQ [Methylobacterium sp. Leaf90] Length = 485 Score = 110 bits (275), Expect = 9e-27 Identities = 53/66 (80%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 478 Query: 59 DRLLSL 42 D LL L Sbjct: 479 DGLLRL 484 >WP_042509060.1 MULTISPECIES: cobyric acid synthase CobQ [Methylobacterium] KQP86316.1 cobalamin biosynthesis protein CobQ [Methylobacterium sp. Leaf119] Length = 485 Score = 110 bits (275), Expect = 9e-27 Identities = 53/66 (80%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 478 Query: 59 DRLLSL 42 D LL L Sbjct: 479 DGLLRL 484 >WP_003600777.1 cobyric acid synthase CobQ [Methylobacterium extorquens] ACS42777.1 cobyric acid synthase [Methylobacterium extorquens AM1] EHP92108.1 cobyric acid synthase CobQ [Methylobacterium extorquens DSM 13060] Length = 485 Score = 110 bits (275), Expect = 9e-27 Identities = 53/66 (80%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 419 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 478 Query: 59 DRLLSL 42 D LL L Sbjct: 479 DGLLRL 484 >ABY33091.1 cobyric acid synthase CobQ [Methylobacterium extorquens PA1] Length = 500 Score = 110 bits (275), Expect = 1e-26 Identities = 53/66 (80%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+ GTYVHGLF+DDRQRAAWLARLGA RYEAGIE VLDRFADHLE HLDC Sbjct: 434 AVSGDGLVTGTYVHGLFADDRQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDC 493 Query: 59 DRLLSL 42 D LL L Sbjct: 494 DGLLRL 499 >CAB40734.1 CobQ protein, partial [Methylobacterium extorquens CM4] Length = 424 Score = 109 bits (273), Expect = 1e-26 Identities = 53/67 (79%), Positives = 58/67 (86%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVSADG +AGTYVHGLF+DDRQRAAWLARLGA AS A YEAGIE VLD A H+E H+DC Sbjct: 357 AVSADGRVAGTYVHGLFADDRQRAAWLARLGAAASGAAYEAGIEAVLDGLARHIEAHVDC 416 Query: 59 DRLLSLA 39 DRLL+LA Sbjct: 417 DRLLALA 423 >WP_041929462.1 cobyric acid synthase CobQ [Methylobacterium extorquens] Length = 479 Score = 109 bits (273), Expect = 2e-26 Identities = 53/67 (79%), Positives = 58/67 (86%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVSADG +AGTYVHGLF+DDRQRAAWLARLGA AS A YEAGIE VLD A H+E H+DC Sbjct: 412 AVSADGRVAGTYVHGLFADDRQRAAWLARLGAAASGAAYEAGIEAVLDGLARHIEAHVDC 471 Query: 59 DRLLSLA 39 DRLL+LA Sbjct: 472 DRLLALA 478 >ACK86437.1 cobyric acid synthase CobQ (plasmid) [Methylobacterium extorquens CM4] Length = 484 Score = 109 bits (273), Expect = 2e-26 Identities = 53/67 (79%), Positives = 58/67 (86%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVSADG +AGTYVHGLF+DDRQRAAWLARLGA AS A YEAGIE VLD A H+E H+DC Sbjct: 417 AVSADGRVAGTYVHGLFADDRQRAAWLARLGAAASGAAYEAGIEAVLDGLARHIEAHVDC 476 Query: 59 DRLLSLA 39 DRLL+LA Sbjct: 477 DRLLALA 483 >WP_017483359.1 cobyric acid synthase CobQ [Methylobacterium sp. MB200] Length = 485 Score = 109 bits (273), Expect = 2e-26 Identities = 52/66 (78%), Positives = 55/66 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVS DGL+AGTYVHGLF+DDRQRAAWL RLGA RYEAGI+ VLDRFADHLE HLDC Sbjct: 419 AVSRDGLVAGTYVHGLFADDRQRAAWLTRLGAAPGDTRYEAGIDEVLDRFADHLEAHLDC 478 Query: 59 DRLLSL 42 D LL L Sbjct: 479 DGLLRL 484 >WP_056091295.1 cobyric acid synthase CobQ [Methylobacterium sp. Leaf99] KQP11472.1 cobalamin biosynthesis protein CobQ [Methylobacterium sp. Leaf99] Length = 479 Score = 108 bits (271), Expect = 3e-26 Identities = 52/67 (77%), Positives = 56/67 (83%) Frame = -3 Query: 239 AVSADGLIAGTYVHGLFSDDRQRAAWLARLGAPASPARYEAGIETVLDRFADHLETHLDC 60 AVSADG +AGTYVHGLF+DD QRAAWLARLGA A YEAGIETVLD ADHLE H+DC Sbjct: 412 AVSADGRVAGTYVHGLFADDAQRAAWLARLGAAAGGGAYEAGIETVLDALADHLEAHVDC 471 Query: 59 DRLLSLA 39 DRL +LA Sbjct: 472 DRLFTLA 478