BLASTX nr result
ID: Glycyrrhiza28_contig00034928
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00034928 (244 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAP03085.1 class IV chitinase [Galega orientalis] 62 2e-09 XP_003597546.1 Chitinase (Class IV) / Hevein [Medicago truncatul... 52 3e-06 NP_001239790.1 uncharacterized protein LOC100778526 precursor [G... 52 6e-06 XP_012570993.1 PREDICTED: endochitinase PR4-like [Cicer arietinum] 50 6e-06 >AAP03085.1 class IV chitinase [Galega orientalis] Length = 275 Score = 61.6 bits (148), Expect = 2e-09 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -1 Query: 136 IMGNKFQSIGIIGVASTLMLVILVPIKSASGQNCGCEAGLCCSQY 2 +MGNK QSI I+G A +++I+VPI + S QNCGC AG+CCSQY Sbjct: 3 MMGNKLQSISIVGFAIAFLIMIIVPI-NVSAQNCGCAAGVCCSQY 46 >XP_003597546.1 Chitinase (Class IV) / Hevein [Medicago truncatula] AES67797.1 Chitinase (Class IV) / Hevein [Medicago truncatula] Length = 175 Score = 52.0 bits (123), Expect = 3e-06 Identities = 24/45 (53%), Positives = 32/45 (71%) Frame = -1 Query: 136 IMGNKFQSIGIIGVASTLMLVILVPIKSASGQNCGCEAGLCCSQY 2 ++GNK S+ I +A ++I+VP KS S QNCGCE GLCCSQ+ Sbjct: 3 MIGNKSLSMSIAKLAIAFFIMIMVP-KSISAQNCGCEEGLCCSQF 46 >NP_001239790.1 uncharacterized protein LOC100778526 precursor [Glycine max] ACU17801.1 unknown [Glycine max] KHN25322.1 Endochitinase PR4 [Glycine soja] KRH24565.1 hypothetical protein GLYMA_12G049200 [Glycine max] Length = 280 Score = 52.0 bits (123), Expect = 6e-06 Identities = 25/48 (52%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = -1 Query: 142 ILIMGNKFQSIGIIGV-ASTLMLVILVPIKSASGQNCGCEAGLCCSQY 2 +++MGN SIG+IGV S L+L+++ S QNCGCEA LCCS+Y Sbjct: 1 MMMMGNNVHSIGVIGVMVSGLVLMMVSKGVSVRAQNCGCEAELCCSKY 48 >XP_012570993.1 PREDICTED: endochitinase PR4-like [Cicer arietinum] Length = 138 Score = 50.4 bits (119), Expect = 6e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 133 MGNKFQSIGIIGVASTLMLVILVPIKSASGQNCGCEAGLCCSQ 5 M K S+ I G+A L ++I+VP KS SGQNCGC GLCCS+ Sbjct: 1 MRYKLVSMSITGLAIALFVIIMVP-KSVSGQNCGCAQGLCCSK 42