BLASTX nr result
ID: Glycyrrhiza28_contig00033103
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033103 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016204826.1 PREDICTED: pentatricopeptide repeat-containing pr... 143 8e-38 XP_015958293.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 2e-37 XP_016197079.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 7e-37 XP_015969806.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 9e-36 XP_014622319.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 4e-34 OIV97404.1 hypothetical protein TanjilG_16165 [Lupinus angustifo... 130 2e-33 XP_019417494.1 PREDICTED: pentatricopeptide repeat-containing pr... 130 3e-33 XP_017973975.1 PREDICTED: pentatricopeptide repeat-containing pr... 130 5e-33 EOY25154.1 Tetratricopeptide repeat-like superfamily protein, pu... 130 5e-33 XP_004512505.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 3e-31 XP_016740980.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 4e-31 XP_007158272.1 hypothetical protein PHAVU_002G138600g [Phaseolus... 124 8e-31 XP_017623797.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 1e-30 GAU41461.1 hypothetical protein TSUD_237110 [Trifolium subterran... 122 2e-30 KDP35484.1 hypothetical protein JCGZ_10931 [Jatropha curcas] 120 2e-30 XP_017623794.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 2e-30 XP_017426117.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 3e-30 XP_014519698.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 4e-30 KYP39447.1 hypothetical protein KK1_039226 [Cajanus cajan] 121 6e-30 XP_012075034.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 9e-30 >XP_016204826.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis ipaensis] Length = 743 Score = 143 bits (361), Expect = 8e-38 Identities = 70/82 (85%), Positives = 74/82 (90%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VLMKVFASNSMLE+AL VFV AKH GLE+DIMSCNFLLKCLVEANRV+FVR FEEL+DS Sbjct: 167 VLMKVFASNSMLENALKVFVNAKHVGLESDIMSCNFLLKCLVEANRVDFVRPFFEELKDS 226 Query: 181 GPSPNIYTYTIMMNFYCREDAG 246 GPSPNIYTYTIMMNFYCR G Sbjct: 227 GPSPNIYTYTIMMNFYCRGGPG 248 >XP_015958293.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis duranensis] Length = 743 Score = 142 bits (359), Expect = 2e-37 Identities = 69/82 (84%), Positives = 74/82 (90%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VLMKVFASNSMLE+A +VFV AKH GLE+DIMSCNFLLKCLVEANRV+FVR FEEL+DS Sbjct: 165 VLMKVFASNSMLENAFNVFVNAKHVGLESDIMSCNFLLKCLVEANRVDFVRPFFEELKDS 224 Query: 181 GPSPNIYTYTIMMNFYCREDAG 246 GPSPNIYTYTIMMNFYCR G Sbjct: 225 GPSPNIYTYTIMMNFYCRGGPG 246 >XP_016197079.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis ipaensis] Length = 745 Score = 140 bits (354), Expect = 7e-37 Identities = 68/82 (82%), Positives = 73/82 (89%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VLMKVFASNSMLE+A +VFV AKH GLE+DIMSCNFLLKCLVE NRV+FVR FEEL+DS Sbjct: 167 VLMKVFASNSMLENAFNVFVNAKHVGLESDIMSCNFLLKCLVEENRVDFVRPFFEELKDS 226 Query: 181 GPSPNIYTYTIMMNFYCREDAG 246 GPSPNIYTYTIMMNFYCR G Sbjct: 227 GPSPNIYTYTIMMNFYCRGGPG 248 >XP_015969806.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis duranensis] Length = 745 Score = 137 bits (346), Expect = 9e-36 Identities = 66/82 (80%), Positives = 72/82 (87%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VLMKVFASNSMLE+A++VFV AKH GLE+DIMSCNFLLKCLVE NRV+FVR FE L+D Sbjct: 167 VLMKVFASNSMLENAVNVFVNAKHVGLESDIMSCNFLLKCLVETNRVDFVRLFFEALKDY 226 Query: 181 GPSPNIYTYTIMMNFYCREDAG 246 GPSPNIYTYTIMMNFYCR G Sbjct: 227 GPSPNIYTYTIMMNFYCRGGPG 248 >XP_014622319.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622332.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622345.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622357.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622368.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] KRH74389.1 hypothetical protein GLYMA_01G016100 [Glycine max] Length = 734 Score = 133 bits (334), Expect = 4e-34 Identities = 67/85 (78%), Positives = 72/85 (84%), Gaps = 3/85 (3%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VL+ VFASNSMLE+ALDVF AKH GLE DI +CNFLLKCLVEANRVEFVR FEEL+D Sbjct: 159 VLISVFASNSMLENALDVFSNAKHVGLEPDIRTCNFLLKCLVEANRVEFVRRVFEELKDR 218 Query: 181 GPSPNIYTYTIMMNFYCRE---DAG 246 GPSPNIYTYTIMMNFYC + DAG Sbjct: 219 GPSPNIYTYTIMMNFYCSDVGCDAG 243 >OIV97404.1 hypothetical protein TanjilG_16165 [Lupinus angustifolius] Length = 622 Score = 130 bits (328), Expect = 2e-33 Identities = 62/80 (77%), Positives = 70/80 (87%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 +L+KVFASNSMLE+ALDVF AKH G+E D+ SCNFLLKCLVEANRV+FVR FEEL+ S Sbjct: 46 MLIKVFASNSMLENALDVFFNAKHVGIEPDVRSCNFLLKCLVEANRVKFVRRFFEELKSS 105 Query: 181 GPSPNIYTYTIMMNFYCRED 240 GPSPNIYTYTIMM+FYC D Sbjct: 106 GPSPNIYTYTIMMDFYCGGD 125 >XP_019417494.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] XP_019417495.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] XP_019417496.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] XP_019417497.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] Length = 744 Score = 130 bits (328), Expect = 3e-33 Identities = 62/80 (77%), Positives = 70/80 (87%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 +L+KVFASNSMLE+ALDVF AKH G+E D+ SCNFLLKCLVEANRV+FVR FEEL+ S Sbjct: 168 MLIKVFASNSMLENALDVFFNAKHVGIEPDVRSCNFLLKCLVEANRVKFVRRFFEELKSS 227 Query: 181 GPSPNIYTYTIMMNFYCRED 240 GPSPNIYTYTIMM+FYC D Sbjct: 228 GPSPNIYTYTIMMDFYCGGD 247 >XP_017973975.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] XP_017973976.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] Length = 746 Score = 130 bits (326), Expect = 5e-33 Identities = 62/83 (74%), Positives = 72/83 (86%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VL+KVFASNSMLE+ +DVFV+AK GLE +IMSCNFLLKCLVEANR EFVR FE++++S Sbjct: 171 VLIKVFASNSMLENGIDVFVQAKKIGLEPNIMSCNFLLKCLVEANRGEFVRSLFEDMKNS 230 Query: 181 GPSPNIYTYTIMMNFYCREDAGR 249 GPSPN+YTYTIMMNFYC GR Sbjct: 231 GPSPNVYTYTIMMNFYCNGYCGR 253 >EOY25154.1 Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 746 Score = 130 bits (326), Expect = 5e-33 Identities = 62/83 (74%), Positives = 72/83 (86%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VL+KVFASNSMLE+ +DVFV+AK GLE +IMSCNFLLKCLVEANR EFVR FE++++S Sbjct: 171 VLIKVFASNSMLENGIDVFVQAKKIGLEPNIMSCNFLLKCLVEANRGEFVRSLFEDMKNS 230 Query: 181 GPSPNIYTYTIMMNFYCREDAGR 249 GPSPN+YTYTIMMNFYC GR Sbjct: 231 GPSPNVYTYTIMMNFYCNGYCGR 253 >XP_004512505.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cicer arietinum] XP_004512506.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cicer arietinum] Length = 666 Score = 125 bits (313), Expect = 3e-31 Identities = 59/79 (74%), Positives = 68/79 (86%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VLMKVFASNSMLEHA VFV A+ G++ IMSCNFLLKCLVEANRV VRC FE+L++ Sbjct: 143 VLMKVFASNSMLEHAYYVFVNAREVGIQPHIMSCNFLLKCLVEANRVNGVRCLFEDLKNF 202 Query: 181 GPSPNIYTYTIMMNFYCRE 237 GP+PNI+TYTIMMNFYCR+ Sbjct: 203 GPTPNIHTYTIMMNFYCRD 221 >XP_016740980.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Gossypium hirsutum] XP_016740987.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Gossypium hirsutum] Length = 738 Score = 124 bits (312), Expect = 4e-31 Identities = 59/83 (71%), Positives = 71/83 (85%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VL+KVFASN M+E+A+DVFV AK G+E IMSCNFLLKCL+EANR EF+R FEE+++S Sbjct: 171 VLIKVFASNLMVENAVDVFVEAKTIGIELSIMSCNFLLKCLLEANRGEFMRSLFEEMKNS 230 Query: 181 GPSPNIYTYTIMMNFYCREDAGR 249 GPSPN+YTYTIMMNFYC+ GR Sbjct: 231 GPSPNVYTYTIMMNFYCKGYYGR 253 >XP_007158272.1 hypothetical protein PHAVU_002G138600g [Phaseolus vulgaris] ESW30266.1 hypothetical protein PHAVU_002G138600g [Phaseolus vulgaris] Length = 831 Score = 124 bits (310), Expect = 8e-31 Identities = 59/77 (76%), Positives = 67/77 (87%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VL+KVFASNSMLE++L+VFV AKH GLE I +CNFLLKCLV+ANR E VR FEEL+D Sbjct: 158 VLIKVFASNSMLENSLNVFVNAKHVGLEPSIRTCNFLLKCLVKANRAECVRWFFEELKDR 217 Query: 181 GPSPNIYTYTIMMNFYC 231 GPSPNI+TYTIMMNFYC Sbjct: 218 GPSPNIHTYTIMMNFYC 234 >XP_017623797.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X2 [Gossypium arboreum] Length = 615 Score = 122 bits (307), Expect = 1e-30 Identities = 58/83 (69%), Positives = 71/83 (85%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VL+KVFAS+ M+E+A+DVFV AK G+E IMSCNFLLKCL+EANR EF+R FEE+++S Sbjct: 48 VLIKVFASSLMVENAVDVFVEAKTIGIELSIMSCNFLLKCLLEANRGEFMRSLFEEMKNS 107 Query: 181 GPSPNIYTYTIMMNFYCREDAGR 249 GPSPN+YTYTIMMNFYC+ GR Sbjct: 108 GPSPNVYTYTIMMNFYCKGYYGR 130 >GAU41461.1 hypothetical protein TSUD_237110 [Trifolium subterraneum] Length = 652 Score = 122 bits (307), Expect = 2e-30 Identities = 57/79 (72%), Positives = 69/79 (87%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 +LMKVFASN+MLEHA VFV AK G+E +IM CNFLLKCLVEANRV+ +RC FE+L++ Sbjct: 54 MLMKVFASNAMLEHAYYVFVSAKDVGIELNIMCCNFLLKCLVEANRVDGMRCLFEDLKNF 113 Query: 181 GPSPNIYTYTIMMNFYCRE 237 GP+PNI+TYTIMMNFYCR+ Sbjct: 114 GPTPNIHTYTIMMNFYCRD 132 >KDP35484.1 hypothetical protein JCGZ_10931 [Jatropha curcas] Length = 433 Score = 120 bits (302), Expect = 2e-30 Identities = 56/82 (68%), Positives = 68/82 (82%) Frame = +1 Query: 4 LMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDSG 183 L+KVFA N M E+ALDVFV+AK GLE I+SCNFLLKC +EAN+VEFVR FEEL+D G Sbjct: 175 LIKVFAENKMFENALDVFVQAKKFGLEPTILSCNFLLKCCIEANQVEFVRSLFEELKDFG 234 Query: 184 PSPNIYTYTIMMNFYCREDAGR 249 PSPN+YTYTIMM++YC+ G+ Sbjct: 235 PSPNVYTYTIMMDYYCKGHLGQ 256 >XP_017623794.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium arboreum] XP_017623795.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium arboreum] XP_017623796.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium arboreum] Length = 738 Score = 122 bits (307), Expect = 2e-30 Identities = 58/83 (69%), Positives = 71/83 (85%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VL+KVFAS+ M+E+A+DVFV AK G+E IMSCNFLLKCL+EANR EF+R FEE+++S Sbjct: 171 VLIKVFASSLMVENAVDVFVEAKTIGIELSIMSCNFLLKCLLEANRGEFMRSLFEEMKNS 230 Query: 181 GPSPNIYTYTIMMNFYCREDAGR 249 GPSPN+YTYTIMMNFYC+ GR Sbjct: 231 GPSPNVYTYTIMMNFYCKGYYGR 253 >XP_017426117.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vigna angularis] XP_017426118.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vigna angularis] KOM45539.1 hypothetical protein LR48_Vigan06g084500 [Vigna angularis] BAU03138.1 hypothetical protein VIGAN_UM017900 [Vigna angularis var. angularis] Length = 732 Score = 122 bits (305), Expect = 3e-30 Identities = 59/77 (76%), Positives = 66/77 (85%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VLMKVFASNSMLE++L VFV AK+ GLE I +CNFLLKCLVEANR + VR FEEL+D Sbjct: 157 VLMKVFASNSMLENSLSVFVNAKNVGLEPHIRTCNFLLKCLVEANRAKCVRWFFEELKDR 216 Query: 181 GPSPNIYTYTIMMNFYC 231 GPSPNI+TYTIMMNFYC Sbjct: 217 GPSPNIHTYTIMMNFYC 233 >XP_014519698.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63130, mitochondrial-like [Vigna radiata var. radiata] Length = 767 Score = 122 bits (305), Expect = 4e-30 Identities = 59/77 (76%), Positives = 66/77 (85%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VLMKVFASNSMLE++L VFV AK+ GLE I +CNFLLKCLVEANR + VR FEEL+D Sbjct: 157 VLMKVFASNSMLENSLSVFVNAKNVGLEPHIRTCNFLLKCLVEANRAKCVRWFFEELKDR 216 Query: 181 GPSPNIYTYTIMMNFYC 231 GPSPNI+TYTIMMNFYC Sbjct: 217 GPSPNIHTYTIMMNFYC 233 >KYP39447.1 hypothetical protein KK1_039226 [Cajanus cajan] Length = 732 Score = 121 bits (303), Expect = 6e-30 Identities = 63/85 (74%), Positives = 68/85 (80%), Gaps = 3/85 (3%) Frame = +1 Query: 1 VLMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDS 180 VL+KVFASNSMLE+ALDVFV AKH GLE DI CNFLLKCLVEANR+EFV FE+L Sbjct: 157 VLIKVFASNSMLENALDVFVNAKHVGLEPDIRVCNFLLKCLVEANRLEFVGWFFEKLTAF 216 Query: 181 GPSPNIYTYTIMMNFYCRE---DAG 246 GP PNIYTYTIMMNFY + DAG Sbjct: 217 GPLPNIYTYTIMMNFYYNDVGCDAG 241 >XP_012075034.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Jatropha curcas] XP_012075035.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Jatropha curcas] XP_012075036.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Jatropha curcas] XP_012075038.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Jatropha curcas] Length = 742 Score = 120 bits (302), Expect = 9e-30 Identities = 56/82 (68%), Positives = 68/82 (82%) Frame = +1 Query: 4 LMKVFASNSMLEHALDVFVRAKHAGLETDIMSCNFLLKCLVEANRVEFVRCHFEELRDSG 183 L+KVFA N M E+ALDVFV+AK GLE I+SCNFLLKC +EAN+VEFVR FEEL+D G Sbjct: 175 LIKVFAENKMFENALDVFVQAKKFGLEPTILSCNFLLKCCIEANQVEFVRSLFEELKDFG 234 Query: 184 PSPNIYTYTIMMNFYCREDAGR 249 PSPN+YTYTIMM++YC+ G+ Sbjct: 235 PSPNVYTYTIMMDYYCKGHLGQ 256