BLASTX nr result
ID: Glycyrrhiza28_contig00029449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00029449 (302 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009334915.1 PREDICTED: probable E3 ubiquitin-protein ligase L... 97 4e-24 EPS57634.1 hypothetical protein M569_17184, partial [Genlisea au... 96 1e-23 XP_003547809.1 PREDICTED: E3 ubiquitin-protein ligase complex SL... 98 8e-23 XP_003520924.1 PREDICTED: E3 ubiquitin-protein ligase complex SL... 97 1e-22 XP_004516309.1 PREDICTED: LON peptidase N-terminal domain and RI... 96 3e-22 XP_004499519.1 PREDICTED: uncharacterized protein LOC101506094 [... 95 3e-22 XP_015949887.1 PREDICTED: chloride channel protein B-like [Arach... 96 4e-22 XP_016186579.1 PREDICTED: uncharacterized protein LOC107628403 [... 96 4e-22 XP_008235738.1 PREDICTED: uncharacterized protein LOC103334536 [... 97 7e-22 XP_018506083.1 PREDICTED: uncharacterized protein LOC103960024 i... 97 7e-22 XP_018506335.1 PREDICTED: E3 ubiquitin-protein ligase complex sl... 97 8e-22 XP_008358459.1 PREDICTED: E3 ubiquitin-protein ligase complex sl... 97 8e-22 XP_018506082.1 PREDICTED: uncharacterized protein LOC103960024 i... 97 8e-22 ONH92876.1 hypothetical protein PRUPE_8G201500 [Prunus persica] ... 97 9e-22 XP_008346202.1 PREDICTED: uncharacterized protein LOC103409173 [... 97 9e-22 XP_014515064.1 PREDICTED: E3 ubiquitin-protein ligase complex SL... 95 9e-22 XP_008358458.1 PREDICTED: E3 ubiquitin-protein ligase complex sl... 97 9e-22 XP_007201323.1 hypothetical protein PRUPE_ppa007571mg [Prunus pe... 97 9e-22 XP_017441513.1 PREDICTED: E3 ubiquitin-protein ligase complex SL... 95 1e-21 XP_007134112.1 hypothetical protein PHAVU_010G019900g [Phaseolus... 94 2e-21 >XP_009334915.1 PREDICTED: probable E3 ubiquitin-protein ligase LUL4 [Pyrus x bretschneideri] Length = 101 Score = 96.7 bits (239), Expect = 4e-24 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 51 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 92 >EPS57634.1 hypothetical protein M569_17184, partial [Genlisea aurea] Length = 104 Score = 95.5 bits (236), Expect = 1e-23 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR CSREVW+ RG CPLCNN Sbjct: 54 YNCCVCMVRHKGAAFIPCGHTFCRRCSREVWVQRGHCPLCNN 95 >XP_003547809.1 PREDICTED: E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8-like [Glycine max] KRH07558.1 hypothetical protein GLYMA_16G094800 [Glycine max] Length = 262 Score = 97.8 bits (242), Expect = 8e-23 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W++RG CPLCNN Sbjct: 212 YNCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSRGNCPLCNN 253 >XP_003520924.1 PREDICTED: E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8-like [Glycine max] KRH66042.1 hypothetical protein GLYMA_03G079200 [Glycine max] Length = 273 Score = 97.4 bits (241), Expect = 1e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR CSRE+W++RG CPLCNN Sbjct: 223 YNCCVCMVRHKGAAFIPCGHTFCRTCSREIWVSRGNCPLCNN 264 >XP_004516309.1 PREDICTED: LON peptidase N-terminal domain and RING finger protein 2-like [Cicer arietinum] Length = 240 Score = 95.9 bits (237), Expect = 3e-22 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 +NCCVCMVRHKGAAFIPCGHTFCR+CSRE+W++RG CPLCNN Sbjct: 190 HNCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSRGNCPLCNN 231 >XP_004499519.1 PREDICTED: uncharacterized protein LOC101506094 [Cicer arietinum] Length = 210 Score = 95.1 bits (235), Expect = 3e-22 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -1 Query: 260 NCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 NCCVCMVRHKGAAFIPCGHTFCR+CSRE+W++RG CPLCNN Sbjct: 161 NCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSRGNCPLCNN 201 >XP_015949887.1 PREDICTED: chloride channel protein B-like [Arachis duranensis] Length = 272 Score = 96.3 bits (238), Expect = 4e-22 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 260 NCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 NCCVCMVRH+GAAFIPCGHTFCR+CSREVW+NRG CPLCNN Sbjct: 223 NCCVCMVRHRGAAFIPCGHTFCRLCSREVWVNRGNCPLCNN 263 >XP_016186579.1 PREDICTED: uncharacterized protein LOC107628403 [Arachis ipaensis] Length = 273 Score = 96.3 bits (238), Expect = 4e-22 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 260 NCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 NCCVCMVRH+GAAFIPCGHTFCR+CSREVW+NRG CPLCNN Sbjct: 224 NCCVCMVRHRGAAFIPCGHTFCRLCSREVWVNRGNCPLCNN 264 >XP_008235738.1 PREDICTED: uncharacterized protein LOC103334536 [Prunus mume] Length = 332 Score = 96.7 bits (239), Expect = 7e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 282 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 323 >XP_018506083.1 PREDICTED: uncharacterized protein LOC103960024 isoform X2 [Pyrus x bretschneideri] Length = 341 Score = 96.7 bits (239), Expect = 7e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 291 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 332 >XP_018506335.1 PREDICTED: E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 [Pyrus x bretschneideri] Length = 351 Score = 96.7 bits (239), Expect = 8e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 301 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 342 >XP_008358459.1 PREDICTED: E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8-like isoform X2 [Malus domestica] Length = 351 Score = 96.7 bits (239), Expect = 8e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 301 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 342 >XP_018506082.1 PREDICTED: uncharacterized protein LOC103960024 isoform X1 [Pyrus x bretschneideri] Length = 353 Score = 96.7 bits (239), Expect = 8e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 303 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 344 >ONH92876.1 hypothetical protein PRUPE_8G201500 [Prunus persica] ONH92877.1 hypothetical protein PRUPE_8G201500 [Prunus persica] Length = 361 Score = 96.7 bits (239), Expect = 9e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 311 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 352 >XP_008346202.1 PREDICTED: uncharacterized protein LOC103409173 [Malus domestica] Length = 361 Score = 96.7 bits (239), Expect = 9e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 311 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 352 >XP_014515064.1 PREDICTED: E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8 [Vigna radiata var. radiata] Length = 268 Score = 95.1 bits (235), Expect = 9e-22 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+C RE+W +RG CPLCNN Sbjct: 218 YNCCVCMVRHKGAAFIPCGHTFCRMCCREIWASRGNCPLCNN 259 >XP_008358458.1 PREDICTED: E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8-like isoform X1 [Malus domestica] Length = 363 Score = 96.7 bits (239), Expect = 9e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 313 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 354 >XP_007201323.1 hypothetical protein PRUPE_ppa007571mg [Prunus persica] Length = 363 Score = 96.7 bits (239), Expect = 9e-22 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE+W+ RG CPLCNN Sbjct: 313 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNN 354 >XP_017441513.1 PREDICTED: E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8-like [Vigna angularis] KOM58308.1 hypothetical protein LR48_Vigan11g134200 [Vigna angularis] BAT97149.1 hypothetical protein VIGAN_09051600 [Vigna angularis var. angularis] Length = 270 Score = 95.1 bits (235), Expect = 1e-21 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 263 YNCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 YNCCVCMVRHKGAAFIPCGHTFCR+C RE+W +RG CPLCNN Sbjct: 220 YNCCVCMVRHKGAAFIPCGHTFCRMCCREIWASRGNCPLCNN 261 >XP_007134112.1 hypothetical protein PHAVU_010G019900g [Phaseolus vulgaris] ESW06106.1 hypothetical protein PHAVU_010G019900g [Phaseolus vulgaris] Length = 262 Score = 94.4 bits (233), Expect = 2e-21 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 260 NCCVCMVRHKGAAFIPCGHTFCRVCSREVWLNRGTCPLCNN 138 NCCVCMVRHKGAAFIPCGHTFCR+CSRE+W +RG CPLCNN Sbjct: 213 NCCVCMVRHKGAAFIPCGHTFCRMCSREIWASRGNCPLCNN 253