BLASTX nr result
ID: Glycyrrhiza28_contig00026267
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026267 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011659862.1 PREDICTED: uncharacterized protein LOC105436307, ... 56 2e-07 XP_011656224.1 PREDICTED: uncharacterized protein LOC105435679 [... 56 2e-07 XP_011659859.1 PREDICTED: uncharacterized protein LOC105436302 [... 56 2e-07 XP_011648465.1 PREDICTED: uncharacterized protein LOC105434474 [... 56 2e-07 XP_011652782.1 PREDICTED: uncharacterized protein LOC105435092 [... 56 2e-07 GAV84528.1 UBN2 domain-containing protein, partial [Cephalotus f... 54 2e-07 XP_012844683.1 PREDICTED: uncharacterized protein LOC105964724 [... 55 3e-07 GAV76031.1 UBN2 domain-containing protein, partial [Cephalotus f... 53 4e-07 GAV90629.1 UBN2 domain-containing protein, partial [Cephalotus f... 53 4e-07 GAV81388.1 UBN2 domain-containing protein [Cephalotus follicularis] 53 4e-07 GAV63761.1 UBN2 domain-containing protein, partial [Cephalotus f... 52 5e-07 GAV89381.1 UBN2 domain-containing protein, partial [Cephalotus f... 52 6e-07 GAV81777.1 UBN2 domain-containing protein, partial [Cephalotus f... 52 6e-07 GAV82685.1 UBN2 domain-containing protein, partial [Cephalotus f... 52 6e-07 GAV79964.1 UBN2 domain-containing protein, partial [Cephalotus f... 52 8e-07 GAV71432.1 UBN2 domain-containing protein [Cephalotus follicularis] 52 8e-07 GAV76346.1 UBN2 domain-containing protein, partial [Cephalotus f... 52 8e-07 GAV85311.1 UBN2 domain-containing protein, partial [Cephalotus f... 52 9e-07 GAV88124.1 UBN2 domain-containing protein [Cephalotus follicularis] 52 9e-07 GAV67712.1 UBN2 domain-containing protein, partial [Cephalotus f... 53 9e-07 >XP_011659862.1 PREDICTED: uncharacterized protein LOC105436307, partial [Cucumis sativus] Length = 324 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYTT E+VRKILRSLP+ W KVTAIQEA+DL Sbjct: 136 KVYTTSENVRKILRSLPKTWEAKVTAIQEAKDL 168 >XP_011656224.1 PREDICTED: uncharacterized protein LOC105435679 [Cucumis sativus] Length = 463 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYTT E+VRKILRSLP+ W KVTAIQEA+DL Sbjct: 99 KVYTTSENVRKILRSLPKTWEAKVTAIQEAKDL 131 >XP_011659859.1 PREDICTED: uncharacterized protein LOC105436302 [Cucumis sativus] Length = 495 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYTT E+VRKILRSLP+ W KVTAIQEA+DL Sbjct: 166 KVYTTSENVRKILRSLPKTWEAKVTAIQEAKDL 198 >XP_011648465.1 PREDICTED: uncharacterized protein LOC105434474 [Cucumis sativus] XP_011658429.1 PREDICTED: uncharacterized protein LOC105434435 [Cucumis sativus] Length = 530 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYTT E+VRKILRSLP+ W KVTAIQEA+DL Sbjct: 166 KVYTTSENVRKILRSLPKTWEAKVTAIQEAKDL 198 >XP_011652782.1 PREDICTED: uncharacterized protein LOC105435092 [Cucumis sativus] Length = 659 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYTT E+VRKILRSLP+ W KVTAIQEA+DL Sbjct: 166 KVYTTSENVRKILRSLPKTWEAKVTAIQEAKDL 198 >GAV84528.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 159 Score = 53.9 bits (128), Expect = 2e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYT E VRKILR LPR W PKVTAI+EA+DL Sbjct: 51 KVYTNSEMVRKILRCLPRMWMPKVTAIEEAKDL 83 >XP_012844683.1 PREDICTED: uncharacterized protein LOC105964724 [Erythranthe guttata] Length = 357 Score = 55.1 bits (131), Expect = 3e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 K+Y+ E V+KILRSLPR+W PKVTAIQEA+DL Sbjct: 165 KIYSQSEQVKKILRSLPREWTPKVTAIQEAKDL 197 >GAV76031.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 123 Score = 52.8 bits (125), Expect = 4e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYT E VRKILR LPR W PKVTAI+EA+DL Sbjct: 17 KVYTNSEMVRKILRCLPRIWMPKVTAIEEAKDL 49 >GAV90629.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 126 Score = 52.8 bits (125), Expect = 4e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 K YT E VRKILRSLP+ W PKVTAI+EA+DL Sbjct: 85 KCYTNSEMVRKILRSLPKSWMPKVTAIEEAKDL 117 >GAV81388.1 UBN2 domain-containing protein [Cephalotus follicularis] Length = 128 Score = 52.8 bits (125), Expect = 4e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYT E VRKILR LP+ W PKVTAI+EA+DL Sbjct: 26 KVYTNHELVRKILRCLPKSWEPKVTAIEEAKDL 58 >GAV63761.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 123 Score = 52.4 bits (124), Expect = 5e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYT E VRKILR LPR W PKVTAI+EA+DL Sbjct: 17 KVYTNSEMVRKILRYLPRIWMPKVTAIEEAKDL 49 >GAV89381.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 111 Score = 52.0 bits (123), Expect = 6e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 K Y+ QE VRKILR LPR W PKVTAI+EA+DL Sbjct: 17 KYYSNQELVRKILRCLPRSWTPKVTAIEEAKDL 49 >GAV81777.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 114 Score = 52.0 bits (123), Expect = 6e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 K Y++QE VRKILR LPR W PKVTAI+EA+DL Sbjct: 17 KSYSSQELVRKILRCLPRSWTPKVTAIEEAKDL 49 >GAV82685.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 101 Score = 51.6 bits (122), Expect = 6e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 K Y+ QE VRKILR LPR W PKVTAI+EA+DL Sbjct: 4 KSYSNQELVRKILRCLPRSWTPKVTAIEEAKDL 36 >GAV79964.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 126 Score = 52.0 bits (123), Expect = 8e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 K YT E VRKILR LP+ W+PKVTAI+EA+DL Sbjct: 85 KCYTNSEMVRKILRCLPKNWKPKVTAIEEAKDL 117 >GAV71432.1 UBN2 domain-containing protein [Cephalotus follicularis] Length = 113 Score = 51.6 bits (122), Expect = 8e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVY+ E VRKILR LPR W PKVTAI+EA+DL Sbjct: 36 KVYSYSEMVRKILRCLPRSWMPKVTAIEEAKDL 68 >GAV76346.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 114 Score = 51.6 bits (122), Expect = 8e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 K Y+ QE VRKILR LPR W PKVTAI+EA+DL Sbjct: 17 KSYSNQELVRKILRCLPRSWTPKVTAIEEAKDL 49 >GAV85311.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 115 Score = 51.6 bits (122), Expect = 9e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 K Y+ QE VRKILR LPR W PKVTAI+EA+DL Sbjct: 26 KSYSNQELVRKILRCLPRNWTPKVTAIEEAKDL 58 >GAV88124.1 UBN2 domain-containing protein [Cephalotus follicularis] Length = 136 Score = 52.0 bits (123), Expect = 9e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 K+YT E V+KILR LPR W PKVTAI+EA+DL Sbjct: 17 KIYTNSEMVKKILRCLPRTWMPKVTAIEEAKDL 49 >GAV67712.1 UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 182 Score = 52.8 bits (125), Expect = 9e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 101 KVYTTQEHVRKILRSLPRQWRPKVTAIQEARDL 3 KVYT E VRKILR LPR W PKVTAI+EA+DL Sbjct: 126 KVYTNTEMVRKILRCLPRMWIPKVTAIEEAKDL 158