BLASTX nr result
ID: Glycyrrhiza28_contig00025934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025934 (343 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004491152.1 PREDICTED: uncharacterized protein LOC101503908 [... 85 2e-17 XP_003617056.1 hypothetical protein MTR_5g087440 [Medicago trunc... 80 1e-15 XP_003616946.1 hypothetical protein MTR_5g086010 [Medicago trunc... 77 2e-14 KRH16589.1 hypothetical protein GLYMA_14G164000 [Glycine max] 75 8e-14 XP_003543804.2 PREDICTED: uncharacterized protein LOC100780489 [... 74 3e-13 XP_014517874.1 PREDICTED: uncharacterized protein LOC106775282 [... 66 2e-10 XP_007141042.1 hypothetical protein PHAVU_008G162400g [Phaseolus... 63 3e-09 XP_007152469.1 hypothetical protein PHAVU_004G133300g [Phaseolus... 62 6e-09 XP_017421039.1 PREDICTED: uncharacterized protein LOC108330949 [... 60 2e-08 XP_019430267.1 PREDICTED: nucleolin [Lupinus angustifolius] 57 2e-07 XP_016176639.1 PREDICTED: uncharacterized protein LOC107618930 [... 54 3e-06 >XP_004491152.1 PREDICTED: uncharacterized protein LOC101503908 [Cicer arietinum] XP_004491153.1 PREDICTED: uncharacterized protein LOC101503908 [Cicer arietinum] Length = 318 Score = 85.1 bits (209), Expect = 2e-17 Identities = 46/61 (75%), Positives = 48/61 (78%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKVFYDLGPAVPRNCNNSASLVNFQALR 4 MGWR SYN LF SL+RVA KPQW+PLSQRSKVFYD G V RNC NSASLVNFQA R Sbjct: 1 MGWR-SFSYNNLFLSLVRVA--KPQWLPLSQRSKVFYDSGLVVLRNCCNSASLVNFQASR 57 Query: 3 S 1 S Sbjct: 58 S 58 >XP_003617056.1 hypothetical protein MTR_5g087440 [Medicago truncatula] AET00015.1 hypothetical protein MTR_5g087440 [Medicago truncatula] Length = 318 Score = 80.1 bits (196), Expect = 1e-15 Identities = 43/61 (70%), Positives = 49/61 (80%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKVFYDLGPAVPRNCNNSASLVNFQALR 4 MGWRL SYN+L SSL+RVA KP VPLSQRSK+FYD GP V +NC N+ASL+NFQ LR Sbjct: 1 MGWRL-FSYNSLSSSLMRVA--KPHRVPLSQRSKIFYDSGPVVLQNCCNNASLLNFQVLR 57 Query: 3 S 1 S Sbjct: 58 S 58 >XP_003616946.1 hypothetical protein MTR_5g086010 [Medicago truncatula] AES99904.1 hypothetical protein MTR_5g086010 [Medicago truncatula] Length = 318 Score = 77.0 bits (188), Expect = 2e-14 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKVFYDLGPAVPRNCNNSASLVNFQALR 4 MGWR SYN+LFSSL+RV KP W+PLSQRSK+FYD G +NC NSASL+NFQA R Sbjct: 1 MGWR-SFSYNSLFSSLMRVP--KPHWLPLSQRSKIFYDSGRVELQNCCNSASLLNFQAWR 57 Query: 3 S 1 + Sbjct: 58 T 58 >KRH16589.1 hypothetical protein GLYMA_14G164000 [Glycine max] Length = 293 Score = 75.1 bits (183), Expect = 8e-14 Identities = 41/61 (67%), Positives = 47/61 (77%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKVFYDLGPAVPRNCNNSASLVNFQALR 4 MG R SYN+LF L+R+A K W+PLSQRSKVFYD GP+VP+N NS SLVNFQALR Sbjct: 1 MGCR-SFSYNSLFPYLLRIA--KSHWLPLSQRSKVFYDPGPSVPQNRCNSGSLVNFQALR 57 Query: 3 S 1 S Sbjct: 58 S 58 >XP_003543804.2 PREDICTED: uncharacterized protein LOC100780489 [Glycine max] KHN33851.1 hypothetical protein glysoja_021732 [Glycine soja] KRH18727.1 hypothetical protein GLYMA_13G079200 [Glycine max] Length = 318 Score = 73.9 bits (180), Expect = 3e-13 Identities = 42/61 (68%), Positives = 46/61 (75%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKVFYDLGPAVPRNCNNSASLVNFQALR 4 MG R SYN+LF SLIRVA K W+PLSQRSKV YD G +V +NC NS SLVNFQALR Sbjct: 1 MGCR-SFSYNSLFPSLIRVA--KSHWLPLSQRSKVVYDSGSSVLQNCCNSGSLVNFQALR 57 Query: 3 S 1 S Sbjct: 58 S 58 >XP_014517874.1 PREDICTED: uncharacterized protein LOC106775282 [Vigna radiata var. radiata] Length = 320 Score = 66.2 bits (160), Expect = 2e-10 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKV--FYDLGPAVPRNCNNSASLVNFQA 10 MG R SYN+LF+SL+RV AK W+PLSQRSK FYD GP+V ++C S SL+NFQ Sbjct: 1 MGCR-SFSYNSLFTSLLRV--AKSHWLPLSQRSKAFYFYDSGPSVLQHCCKSGSLLNFQG 57 Query: 9 LRS 1 LRS Sbjct: 58 LRS 60 >XP_007141042.1 hypothetical protein PHAVU_008G162400g [Phaseolus vulgaris] XP_007141043.1 hypothetical protein PHAVU_008G162400g [Phaseolus vulgaris] ESW13036.1 hypothetical protein PHAVU_008G162400g [Phaseolus vulgaris] ESW13037.1 hypothetical protein PHAVU_008G162400g [Phaseolus vulgaris] Length = 320 Score = 62.8 bits (151), Expect = 3e-09 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKVFY--DLGPAVPRNCNNSASLVNFQA 10 MG R SYN+ F SL+RVA K +PLSQRS+VFY D GP+V ++C NS SL+NFQA Sbjct: 1 MGCR-SFSYNSFFPSLLRVA--KSHLLPLSQRSEVFYFYDSGPSVLQHCCNSGSLMNFQA 57 Query: 9 LRS 1 LRS Sbjct: 58 LRS 60 >XP_007152469.1 hypothetical protein PHAVU_004G133300g [Phaseolus vulgaris] XP_007152470.1 hypothetical protein PHAVU_004G133300g [Phaseolus vulgaris] ESW24463.1 hypothetical protein PHAVU_004G133300g [Phaseolus vulgaris] ESW24464.1 hypothetical protein PHAVU_004G133300g [Phaseolus vulgaris] Length = 321 Score = 62.0 bits (149), Expect = 6e-09 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKVFY--DLGPAVPRNCNNSASLVNFQA 10 MG R SYN+LF SL+RVA K +PLSQRS+VFY D GP++ ++C NS SL NFQA Sbjct: 1 MGCR-SFSYNSLFPSLLRVA--KSHLLPLSQRSEVFYFYDSGPSLLQHCCNSGSLKNFQA 57 Query: 9 LRS 1 LRS Sbjct: 58 LRS 60 >XP_017421039.1 PREDICTED: uncharacterized protein LOC108330949 [Vigna angularis] KOM41382.1 hypothetical protein LR48_Vigan04g158000 [Vigna angularis] BAT78821.1 hypothetical protein VIGAN_02155900 [Vigna angularis var. angularis] Length = 320 Score = 60.5 bits (145), Expect = 2e-08 Identities = 37/63 (58%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKV--FYDLGPAVPRNCNNSASLVNFQA 10 MG R SYN+LF SL+RV AK +PLSQRSK FYD GP+V ++C S SL+NFQ Sbjct: 1 MGCR-SFSYNSLFPSLLRV--AKSHCLPLSQRSKAFYFYDSGPSVLQHCCKSGSLLNFQG 57 Query: 9 LRS 1 LRS Sbjct: 58 LRS 60 >XP_019430267.1 PREDICTED: nucleolin [Lupinus angustifolius] Length = 318 Score = 57.4 bits (137), Expect = 2e-07 Identities = 32/61 (52%), Positives = 42/61 (68%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKVFYDLGPAVPRNCNNSASLVNFQALR 4 M WRL S + FSS++RVA KP W+PLS+ ++ F V R+C+N+ SLVNFQALR Sbjct: 1 MAWRL-WSCSVPFSSILRVA--KPHWLPLSRSTEAFCGSVSCVLRSCHNNVSLVNFQALR 57 Query: 3 S 1 S Sbjct: 58 S 58 >XP_016176639.1 PREDICTED: uncharacterized protein LOC107618930 [Arachis ipaensis] Length = 318 Score = 54.3 bits (129), Expect = 3e-06 Identities = 30/61 (49%), Positives = 41/61 (67%) Frame = -2 Query: 183 MGWRLPLSYNTLFSSLIRVANAKPQWVPLSQRSKVFYDLGPAVPRNCNNSASLVNFQALR 4 MGWR SY LF S++RVA K VP+SQ+SKVFY P V + C ++ ++NFQA+R Sbjct: 1 MGWR-SRSYTGLFLSVVRVA--KSHSVPVSQKSKVFYYSAPGVLKGCFSNGYVMNFQAIR 57 Query: 3 S 1 + Sbjct: 58 T 58