BLASTX nr result
ID: Glycyrrhiza28_contig00025169
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025169 (218 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024578333.1 MULTISPECIES: PEP-CTERM sorting domain-containing... 140 1e-40 >WP_024578333.1 MULTISPECIES: PEP-CTERM sorting domain-containing protein [Bradyrhizobium] KIU48055.1 hypothetical protein QU41_16620 [Bradyrhizobium elkanii] OCX30966.1 hypothetical protein QU42_12570 [Bradyrhizobium sp. UASWS1016] Length = 196 Score = 140 bits (353), Expect = 1e-40 Identities = 67/71 (94%), Positives = 69/71 (97%) Frame = +3 Query: 6 LVDYGVTFSTWSGTSVGTGVLVLDLPSFPTTGPINWTSLPNPIFSSLTATFGTLSFELTN 185 LVDYGVTFS WSGTSVGTGVLVLDLPSFPTTGPINWTSLPNPIFSSL+ATFGTL+FELTN Sbjct: 21 LVDYGVTFSNWSGTSVGTGVLVLDLPSFPTTGPINWTSLPNPIFSSLSATFGTLNFELTN 80 Query: 186 SNIAFGSLQGA 218 SNIAFG LQGA Sbjct: 81 SNIAFGGLQGA 91