BLASTX nr result
ID: Glycyrrhiza28_contig00024485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00024485 (562 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007141512.1 hypothetical protein PHAVU_008G202300g [Phaseolus... 56 5e-06 >XP_007141512.1 hypothetical protein PHAVU_008G202300g [Phaseolus vulgaris] ESW13506.1 hypothetical protein PHAVU_008G202300g [Phaseolus vulgaris] Length = 633 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 470 KRFKHGELLFGRNKLFSLMLGKSQTSQLGG 559 KR KHGELLFGRNKLFSLM+GKSQTS+ GG Sbjct: 225 KRVKHGELLFGRNKLFSLMVGKSQTSRTGG 254