BLASTX nr result
ID: Glycyrrhiza28_contig00024345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00024345 (426 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU20453.1 hypothetical protein TSUD_130110, partial [Trifolium ... 55 6e-07 >GAU20453.1 hypothetical protein TSUD_130110, partial [Trifolium subterraneum] Length = 116 Score = 54.7 bits (130), Expect = 6e-07 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 310 LPRTTLTRVTIAMLAAIRRINTVAEEIARLTRFSLHAPK 426 LP +TR T AML AIRRINTVAE+ ARLTRFSL PK Sbjct: 41 LPLAAVTRATKAMLVAIRRINTVAEQTARLTRFSLQPPK 79