BLASTX nr result
ID: Glycyrrhiza28_contig00019424
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00019424 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020050895.1 hypothetical protein ASPACDRAFT_1877672 [Aspergil... 58 9e-09 XP_006455549.1 hypothetical protein AGABI2DRAFT_75872, partial [... 55 2e-08 XP_007389360.1 hypothetical protein PUNSTDRAFT_78207, partial [P... 53 6e-07 XP_007402183.1 hypothetical protein PHACADRAFT_107117, partial [... 51 1e-06 XP_008045701.1 hypothetical protein TRAVEDRAFT_137431, partial [... 51 1e-06 KXN87604.1 Protein TAR1, partial [Leucoagaricus sp. SymC.cos] 50 3e-06 >XP_020050895.1 hypothetical protein ASPACDRAFT_1877672 [Aspergillus aculeatus ATCC 16872] XP_020050892.1 hypothetical protein ASPACDRAFT_37813 [Aspergillus aculeatus ATCC 16872] OJJ94552.1 hypothetical protein ASPACDRAFT_37813 [Aspergillus aculeatus ATCC 16872] OJJ94555.1 hypothetical protein ASPACDRAFT_1877672 [Aspergillus aculeatus ATCC 16872] Length = 118 Score = 58.2 bits (139), Expect = 9e-09 Identities = 45/106 (42%), Positives = 49/106 (46%), Gaps = 7/106 (6%) Frame = +3 Query: 3 RVV*SHYVNIL-----SSNVGEPRPMKASCIPQSHPTYAMTGYNTPRRCYIPATLIRRTK 167 RVV HY ++ S+ G P C P H YIP R K Sbjct: 11 RVVCDHYASVRAEARSSAQAGRIAPPAIRC-PGGH--------------YIPEAFDRPPK 55 Query: 168 LMLTRPRGIH--RRSAEPPGHD*LQSFPF*QFHVLFNSLSKVLFIF 299 L L RPRG R AEP G Q+ PF QFHVLFNSL KVLFIF Sbjct: 56 LTLARPRGSTPARVPAEPRGRVWSQALPFQQFHVLFNSLFKVLFIF 101 >XP_006455549.1 hypothetical protein AGABI2DRAFT_75872, partial [Agaricus bisporus var. bisporus H97] XP_006458829.1 hypothetical protein AGABI2DRAFT_80166, partial [Agaricus bisporus var. bisporus H97] XP_007335029.1 hypothetical protein AGABI1DRAFT_48203, partial [Agaricus bisporus var. burnettii JB137-S8] EKM74328.1 hypothetical protein AGABI1DRAFT_48203, partial [Agaricus bisporus var. burnettii JB137-S8] EKV41603.1 hypothetical protein AGABI2DRAFT_80166, partial [Agaricus bisporus var. bisporus H97] EKV44288.1 hypothetical protein AGABI2DRAFT_75872, partial [Agaricus bisporus var. bisporus H97] Length = 51 Score = 55.5 bits (132), Expect = 2e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 220 DTTDFNRFPFNNFTYCLTLFPKCFSSFP 303 + TDF RFPF+NFTYCLTLFPK FSSFP Sbjct: 2 NATDFKRFPFSNFTYCLTLFPKFFSSFP 29 >XP_007389360.1 hypothetical protein PUNSTDRAFT_78207, partial [Punctularia strigosozonata HHB-11173 SS5] EIN03413.1 hypothetical protein PUNSTDRAFT_78207, partial [Punctularia strigosozonata HHB-11173 SS5] Length = 90 Score = 52.8 bits (125), Expect = 6e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 241 FPFNNFTYCLTLFPKCFSSFP 303 FPFNNFTYCLTLFPKCFSSFP Sbjct: 1 FPFNNFTYCLTLFPKCFSSFP 21 >XP_007402183.1 hypothetical protein PHACADRAFT_107117, partial [Phanerochaete carnosa HHB-10118-sp] EKM49265.1 hypothetical protein PHACADRAFT_107117, partial [Phanerochaete carnosa HHB-10118-sp] EMD30417.1 hypothetical protein CERSUDRAFT_61185, partial [Gelatoporia subvermispora B] Length = 53 Score = 50.8 bits (120), Expect = 1e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +1 Query: 241 FPFNNFTYCLTLFPKCFSSFP 303 FPF+NFTYCLTLFPKCFSSFP Sbjct: 1 FPFSNFTYCLTLFPKCFSSFP 21 >XP_008045701.1 hypothetical protein TRAVEDRAFT_137431, partial [Trametes versicolor FP-101664 SS1] EIW51414.1 hypothetical protein TRAVEDRAFT_137431, partial [Trametes versicolor FP-101664 SS1] Length = 53 Score = 50.8 bits (120), Expect = 1e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +1 Query: 241 FPFNNFTYCLTLFPKCFSSFP 303 FPF+NFTYCLTLFPKCFSSFP Sbjct: 1 FPFSNFTYCLTLFPKCFSSFP 21 >KXN87604.1 Protein TAR1, partial [Leucoagaricus sp. SymC.cos] Length = 51 Score = 50.1 bits (118), Expect = 3e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +1 Query: 220 DTTDFNRFPFNNFTYCLTLFPKCFSSFP 303 + TDF FPF+NF YCLTLFPK FSSFP Sbjct: 2 NVTDFKCFPFSNFMYCLTLFPKFFSSFP 29