BLASTX nr result
ID: Glycyrrhiza28_contig00017569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00017569 (240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004512772.1 PREDICTED: NF-X1-type zinc finger protein NFXL1 [... 56 2e-07 KHN45264.1 NF-X1-type zinc finger protein NFXL1 [Glycine soja] 54 1e-06 KRH48678.1 hypothetical protein GLYMA_07G104700 [Glycine max] 54 1e-06 XP_006583471.1 PREDICTED: NF-X1-type zinc finger protein NFXL1-l... 54 1e-06 KHN43649.1 NF-X1-type zinc finger protein NFXL1 [Glycine soja] 53 3e-06 XP_003619874.1 NF-X1-type zinc finger protein NFXL1 [Medicago tr... 53 3e-06 XP_003533318.1 PREDICTED: NF-X1-type zinc finger protein NFXL1-l... 53 3e-06 >XP_004512772.1 PREDICTED: NF-X1-type zinc finger protein NFXL1 [Cicer arietinum] Length = 1109 Score = 56.2 bits (134), Expect = 2e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 103 MSLQVRRERREWSRAPSQTAPRQEWVPKGSGGAS 2 MSLQ RRERRE SR PSQ APRQEWVPKG+G ++ Sbjct: 1 MSLQQRRERREGSRFPSQRAPRQEWVPKGAGASN 34 >KHN45264.1 NF-X1-type zinc finger protein NFXL1 [Glycine soja] Length = 885 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 103 MSLQVRRERREWSRAPSQTAPRQEWVPKGSGGAS 2 MS Q+RRERREWSR P Q A RQEWVP+G+ A+ Sbjct: 1 MSSQIRRERREWSRVPPQGATRQEWVPRGAAAAA 34 >KRH48678.1 hypothetical protein GLYMA_07G104700 [Glycine max] Length = 1200 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 103 MSLQVRRERREWSRAPSQTAPRQEWVPKGSGGAS 2 MS Q+RRERREWSR P Q A RQEWVP+G+ A+ Sbjct: 1 MSSQIRRERREWSRVPPQGATRQEWVPRGAAAAA 34 >XP_006583471.1 PREDICTED: NF-X1-type zinc finger protein NFXL1-like [Glycine max] XP_014633398.1 PREDICTED: NF-X1-type zinc finger protein NFXL1-like [Glycine max] KRH48677.1 hypothetical protein GLYMA_07G104700 [Glycine max] Length = 1227 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 103 MSLQVRRERREWSRAPSQTAPRQEWVPKGSGGAS 2 MS Q+RRERREWSR P Q A RQEWVP+G+ A+ Sbjct: 1 MSSQIRRERREWSRVPPQGATRQEWVPRGAAAAA 34 >KHN43649.1 NF-X1-type zinc finger protein NFXL1 [Glycine soja] Length = 1139 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 103 MSLQVRRERREWSRAPSQTAPRQEWVPKGSGGAS 2 MS Q+RRERR+WSR P Q A RQEWVP+G+ AS Sbjct: 1 MSSQLRRERRDWSRVPPQGATRQEWVPRGAAAAS 34 >XP_003619874.1 NF-X1-type zinc finger protein NFXL1 [Medicago truncatula] AES76092.1 NF-X1-type zinc finger protein NFXL1 [Medicago truncatula] Length = 1173 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -3 Query: 103 MSLQVRRERREWSRAPSQTAPRQEWVPKGSGGAS 2 MSLQ RRERRE SR PS PRQEW+PKG+G +S Sbjct: 1 MSLQQRRERREGSRFPSHRPPRQEWIPKGAGASS 34 >XP_003533318.1 PREDICTED: NF-X1-type zinc finger protein NFXL1-like [Glycine max] XP_014617705.1 PREDICTED: NF-X1-type zinc finger protein NFXL1-like [Glycine max] KRH39028.1 hypothetical protein GLYMA_09G173000 [Glycine max] KRH39029.1 hypothetical protein GLYMA_09G173000 [Glycine max] Length = 1270 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 103 MSLQVRRERREWSRAPSQTAPRQEWVPKGSGGAS 2 MS Q+RRERR+WSR P Q A RQEWVP+G+ AS Sbjct: 1 MSSQLRRERRDWSRVPPQGATRQEWVPRGAAAAS 34