BLASTX nr result
ID: Glycyrrhiza28_contig00016916
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00016916 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004507735.1 PREDICTED: probable WRKY transcription factor 32 ... 66 3e-10 >XP_004507735.1 PREDICTED: probable WRKY transcription factor 32 [Cicer arietinum] Length = 509 Score = 65.9 bits (159), Expect = 3e-10 Identities = 40/70 (57%), Positives = 46/70 (65%), Gaps = 5/70 (7%) Frame = +3 Query: 144 MAEH-SSEALPAGATELHRKGNDSESNDGSQ----EEKEKAVEIKERVGESPSATELQRG 308 M EH SEALP G TEL K NDS+S D +Q EE+EKA EI+ERVGESP ATE Q G Sbjct: 1 MTEHRGSEALPVGPTELLPKENDSKSYDRNQVEEEEEEEKAEEIEERVGESPPATESQLG 60 Query: 309 DLPSSNEHTM 338 + N T+ Sbjct: 61 NSNEPNSETL 70