BLASTX nr result
ID: Glycyrrhiza28_contig00016617
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00016617 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU36709.1 hypothetical protein TSUD_217660 [Trifolium subterran... 51 3e-06 >GAU36709.1 hypothetical protein TSUD_217660 [Trifolium subterraneum] Length = 77 Score = 51.2 bits (121), Expect = 3e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 335 RMEHSQARCRWGMSEIDVQFACNITFKIAID 243 RMEHSQARCR SEID QF C+ITFKIA D Sbjct: 32 RMEHSQARCRRDKSEIDAQFTCSITFKIARD 62