BLASTX nr result
ID: Glycyrrhiza28_contig00012993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00012993 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHM99626.1 hypothetical protein glysoja_006469 [Glycine soja] 78 4e-16 XP_010102159.1 hypothetical protein L484_021393 [Morus notabilis... 54 4e-07 >KHM99626.1 hypothetical protein glysoja_006469 [Glycine soja] Length = 92 Score = 77.8 bits (190), Expect = 4e-16 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 295 KGRCMWDLIWVHCLVKD-LAKGRISWDCCAFVIMSRGRWGKCG 420 KGRCMWD WV CLVK L +GR SWDCC FVIMSRGRWGKCG Sbjct: 50 KGRCMWDPNWVLCLVKKGLGEGRKSWDCCGFVIMSRGRWGKCG 92 >XP_010102159.1 hypothetical protein L484_021393 [Morus notabilis] EXB92409.1 hypothetical protein L484_021393 [Morus notabilis] Length = 76 Score = 54.3 bits (129), Expect = 4e-07 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +1 Query: 301 RCMWDLIWVH-CLVKDLAKGRISWDCCAFVIMSRGRWGKCG 420 +CM DL W + C VKDL + RI WDC +FVI SRGRWGKCG Sbjct: 38 KCMRDLAWWNLCCVKDLGR-RIRWDC-SFVIRSRGRWGKCG 76