BLASTX nr result
ID: Glycyrrhiza28_contig00008691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00008691 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KIV62142.1 hypothetical protein SZ54_4265 [Rhizobium sp. UR51a] 50 1e-06 >KIV62142.1 hypothetical protein SZ54_4265 [Rhizobium sp. UR51a] Length = 39 Score = 50.4 bits (119), Expect = 1e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 157 LVAPDIEL*RAKIKACGEKLAAFSDLAALS 246 +VAPDIEL RAKIKACGEKLAAFS LA LS Sbjct: 1 MVAPDIELWRAKIKACGEKLAAFSFLAGLS 30