BLASTX nr result
ID: Glycyrrhiza28_contig00007420
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00007420 (265 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP76016.1 hypothetical protein KK1_020234 [Cajanus cajan] 66 7e-11 XP_004488279.1 PREDICTED: ankyrin repeat domain-containing prote... 65 2e-10 KRG98010.1 hypothetical protein GLYMA_18G044300 [Glycine max] 64 3e-10 XP_003552889.1 PREDICTED: ankyrin repeat domain-containing prote... 64 3e-10 KRH20043.1 hypothetical protein GLYMA_13G152400 [Glycine max] 60 7e-09 XP_006591310.1 PREDICTED: ankyrin repeat domain-containing prote... 60 8e-09 XP_019416888.1 PREDICTED: ankyrin repeat domain-containing prote... 57 2e-07 OIV97287.1 hypothetical protein TanjilG_07039 [Lupinus angustifo... 57 2e-07 >KYP76016.1 hypothetical protein KK1_020234 [Cajanus cajan] Length = 331 Score = 66.2 bits (160), Expect = 7e-11 Identities = 33/50 (66%), Positives = 36/50 (72%) Frame = -3 Query: 152 MGSWATAYVLPNQFIPFSATITNYAMNSKLGASFHKIYRSTNKGKFSLSF 3 MGSWA VL NQFIP S T T M+SKLGA F+KIYR+TNK K LSF Sbjct: 1 MGSWAKVSVLTNQFIPRSTTNTESGMDSKLGAGFYKIYRNTNKRKLGLSF 50 >XP_004488279.1 PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Cicer arietinum] XP_012574772.1 PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Cicer arietinum] Length = 330 Score = 65.1 bits (157), Expect = 2e-10 Identities = 33/50 (66%), Positives = 36/50 (72%) Frame = -3 Query: 152 MGSWATAYVLPNQFIPFSATITNYAMNSKLGASFHKIYRSTNKGKFSLSF 3 M AT L NQFIPFS ITN AM+SKLGASFH+IY+S K KF LSF Sbjct: 1 MSCLATPSFLANQFIPFSTAITNSAMSSKLGASFHRIYKSKTKEKFCLSF 50 >KRG98010.1 hypothetical protein GLYMA_18G044300 [Glycine max] Length = 278 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = -3 Query: 152 MGSWATAYVLPNQFIPFSATITNYAMNSKLGASFHKIYRSTNKGKFSLSF 3 MGSWAT+ VL NQFIP+S T + A++SKLG F+K+YR+TNK + SL+F Sbjct: 1 MGSWATSSVLANQFIPWSTTNSESAIDSKLGVVFYKMYRNTNKRQLSLAF 50 >XP_003552889.1 PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Glycine max] KRG98009.1 hypothetical protein GLYMA_18G044300 [Glycine max] Length = 331 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = -3 Query: 152 MGSWATAYVLPNQFIPFSATITNYAMNSKLGASFHKIYRSTNKGKFSLSF 3 MGSWAT+ VL NQFIP+S T + A++SKLG F+K+YR+TNK + SL+F Sbjct: 1 MGSWATSSVLANQFIPWSTTNSESAIDSKLGVVFYKMYRNTNKRQLSLAF 50 >KRH20043.1 hypothetical protein GLYMA_13G152400 [Glycine max] Length = 297 Score = 60.5 bits (145), Expect = 7e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -3 Query: 152 MGSWATAYVLPNQFIPFSATITNYAMNSKLGASFHKIYRSTNKGKFSLSF 3 MGS AT+ VL NQFIP+S T T ++SKLG F+K+YR+TNK + SLSF Sbjct: 1 MGSCATSSVLTNQFIPWSTTNTESPLDSKLGVIFYKMYRNTNKRQLSLSF 50 >XP_006591310.1 PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Glycine max] KHN24175.1 Ankyrin repeat domain-containing protein, chloroplastic [Glycine soja] KRH20044.1 hypothetical protein GLYMA_13G152400 [Glycine max] Length = 330 Score = 60.5 bits (145), Expect = 8e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -3 Query: 152 MGSWATAYVLPNQFIPFSATITNYAMNSKLGASFHKIYRSTNKGKFSLSF 3 MGS AT+ VL NQFIP+S T T ++SKLG F+K+YR+TNK + SLSF Sbjct: 1 MGSCATSSVLTNQFIPWSTTNTESPLDSKLGVIFYKMYRNTNKRQLSLSF 50 >XP_019416888.1 PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic [Lupinus angustifolius] XP_019416889.1 PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic [Lupinus angustifolius] Length = 332 Score = 56.6 bits (135), Expect = 2e-07 Identities = 29/50 (58%), Positives = 33/50 (66%) Frame = -3 Query: 152 MGSWATAYVLPNQFIPFSATITNYAMNSKLGASFHKIYRSTNKGKFSLSF 3 MGSWAT VL Q IP S I A NSK GA+ +K+ RSTNKGK + SF Sbjct: 1 MGSWATTSVLSIQSIPLSTIIAEAATNSKFGANSYKLNRSTNKGKLTRSF 50 >OIV97287.1 hypothetical protein TanjilG_07039 [Lupinus angustifolius] Length = 426 Score = 56.6 bits (135), Expect = 2e-07 Identities = 29/50 (58%), Positives = 33/50 (66%) Frame = -3 Query: 152 MGSWATAYVLPNQFIPFSATITNYAMNSKLGASFHKIYRSTNKGKFSLSF 3 MGSWAT VL Q IP S I A NSK GA+ +K+ RSTNKGK + SF Sbjct: 1 MGSWATTSVLSIQSIPLSTIIAEAATNSKFGANSYKLNRSTNKGKLTRSF 50