BLASTX nr result
ID: Glycyrrhiza28_contig00006337
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00006337 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU23995.1 hypothetical protein TSUD_327960 [Trifolium subterran... 134 2e-35 XP_014491175.1 PREDICTED: cationic amino acid transporter 2, vac... 134 4e-35 XP_004493215.1 PREDICTED: cationic amino acid transporter 2, vac... 133 5e-35 XP_010534036.1 PREDICTED: cationic amino acid transporter 2, vac... 122 1e-34 XP_003624709.1 cationic amino acid transporter 2, vacuolar prote... 132 1e-34 XP_017417629.1 PREDICTED: cationic amino acid transporter 2, vac... 132 2e-34 KJB44492.1 hypothetical protein B456_007G255700 [Gossypium raimo... 130 4e-34 XP_010666877.1 PREDICTED: cationic amino acid transporter 2, vac... 130 6e-34 XP_017630745.1 PREDICTED: cationic amino acid transporter 2, vac... 130 8e-34 XP_016671500.1 PREDICTED: cationic amino acid transporter 2, vac... 130 8e-34 KJB44491.1 hypothetical protein B456_007G255700 [Gossypium raimo... 130 8e-34 XP_012492462.1 PREDICTED: cationic amino acid transporter 2, vac... 130 8e-34 KHG19285.1 Cationic amino acid transporter 4, vacuolar -like pro... 130 1e-33 XP_009343029.1 PREDICTED: cationic amino acid transporter 2, vac... 130 1e-33 XP_009366507.1 PREDICTED: cationic amino acid transporter 2, vac... 130 1e-33 XP_008386874.1 PREDICTED: cationic amino acid transporter 2, vac... 130 1e-33 XP_009343028.1 PREDICTED: cationic amino acid transporter 2, vac... 130 1e-33 XP_008386873.1 PREDICTED: cationic amino acid transporter 2, vac... 130 1e-33 KRG94900.1 hypothetical protein GLYMA_19G116500 [Glycine max] 129 1e-33 XP_008244218.1 PREDICTED: cationic amino acid transporter 2, vac... 129 1e-33 >GAU23995.1 hypothetical protein TSUD_327960 [Trifolium subterraneum] Length = 622 Score = 134 bits (338), Expect = 2e-35 Identities = 67/70 (95%), Positives = 69/70 (98%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTV HLIAIGVGSTIGAGVYVLVGTVAREH+GP+LAISFLIAGLAAGLSAFCYAELA Sbjct: 35 AKELTVSHLIAIGVGSTIGAGVYVLVGTVAREHSGPALAISFLIAGLAAGLSAFCYAELA 94 Query: 183 CRCPSAGSAY 212 CRCPSAGSAY Sbjct: 95 CRCPSAGSAY 104 >XP_014491175.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like [Vigna radiata var. radiata] Length = 632 Score = 134 bits (336), Expect = 4e-35 Identities = 67/70 (95%), Positives = 69/70 (98%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 A+ELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGP+LAISFLIAGLAAGLSAFCYAELA Sbjct: 39 ARELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPALAISFLIAGLAAGLSAFCYAELA 98 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 99 SRCPSAGSAY 108 >XP_004493215.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like [Cicer arietinum] Length = 612 Score = 133 bits (335), Expect = 5e-35 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTV HLIAIGVGSTIGAGVYVLVGTVA+EH+GP+LAISFLIAGLAAGLSAFCYAELA Sbjct: 35 AKELTVSHLIAIGVGSTIGAGVYVLVGTVAKEHSGPALAISFLIAGLAAGLSAFCYAELA 94 Query: 183 CRCPSAGSAY 212 CRCPSAGSAY Sbjct: 95 CRCPSAGSAY 104 >XP_010534036.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like, partial [Tarenaya hassleriana] Length = 125 Score = 122 bits (307), Expect = 1e-34 Identities = 59/70 (84%), Positives = 65/70 (92%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AK LTVPHLIAIGVG+TIGAGVY+LVGTVAREH+GP+L SFLIAG+AA LSAFCYAEL+ Sbjct: 42 AKALTVPHLIAIGVGATIGAGVYILVGTVAREHSGPALTFSFLIAGIAAALSAFCYAELS 101 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 102 SRCPSAGSAY 111 >XP_003624709.1 cationic amino acid transporter 2, vacuolar protein [Medicago truncatula] AES80927.1 cationic amino acid transporter 2, vacuolar protein [Medicago truncatula] Length = 618 Score = 132 bits (332), Expect = 1e-34 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKEL+V HLIAIGVGSTIGAGVYVLVGTVAREH+GP+LAISFLIAGLAAGLSAFCYAELA Sbjct: 33 AKELSVYHLIAIGVGSTIGAGVYVLVGTVAREHSGPALAISFLIAGLAAGLSAFCYAELA 92 Query: 183 CRCPSAGSAY 212 CRCPSAGSAY Sbjct: 93 CRCPSAGSAY 102 >XP_017417629.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like [Vigna angularis] KOM38598.1 hypothetical protein LR48_Vigan03g198000 [Vigna angularis] BAT84978.1 hypothetical protein VIGAN_04246400 [Vigna angularis var. angularis] Length = 632 Score = 132 bits (331), Expect = 2e-34 Identities = 66/70 (94%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 A+ELTVPHLIAIGVGSTIGAGVYVLVG VAREHAGP+LAISFLIAGLAAGLSAFCYAELA Sbjct: 39 ARELTVPHLIAIGVGSTIGAGVYVLVGAVAREHAGPALAISFLIAGLAAGLSAFCYAELA 98 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 99 SRCPSAGSAY 108 >KJB44492.1 hypothetical protein B456_007G255700 [Gossypium raimondii] Length = 536 Score = 130 bits (327), Expect = 4e-34 Identities = 64/70 (91%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHLIAIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 42 AKELTVPHLIAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 101 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 102 SRCPSAGSAY 111 >XP_010666877.1 PREDICTED: cationic amino acid transporter 2, vacuolar [Beta vulgaris subsp. vulgaris] KMS95770.1 hypothetical protein BVRB_005140 [Beta vulgaris subsp. vulgaris] Length = 637 Score = 130 bits (328), Expect = 6e-34 Identities = 63/70 (90%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AK LTVPHL+AIGVGSTIGAGVY+L+GTVAREH+GPSLAISFLIAG+AAGLSAFCYAELA Sbjct: 45 AKALTVPHLVAIGVGSTIGAGVYILIGTVAREHSGPSLAISFLIAGIAAGLSAFCYAELA 104 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 105 SRCPSAGSAY 114 >XP_017630745.1 PREDICTED: cationic amino acid transporter 2, vacuolar [Gossypium arboreum] Length = 638 Score = 130 bits (327), Expect = 8e-34 Identities = 64/70 (91%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHLIAIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 42 AKELTVPHLIAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 101 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 102 SRCPSAGSAY 111 >XP_016671500.1 PREDICTED: cationic amino acid transporter 2, vacuolar [Gossypium hirsutum] Length = 638 Score = 130 bits (327), Expect = 8e-34 Identities = 64/70 (91%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHLIAIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 42 AKELTVPHLIAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 101 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 102 SRCPSAGSAY 111 >KJB44491.1 hypothetical protein B456_007G255700 [Gossypium raimondii] Length = 640 Score = 130 bits (327), Expect = 8e-34 Identities = 64/70 (91%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHLIAIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 42 AKELTVPHLIAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 101 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 102 SRCPSAGSAY 111 >XP_012492462.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like [Gossypium raimondii] KJB44490.1 hypothetical protein B456_007G255700 [Gossypium raimondii] Length = 642 Score = 130 bits (327), Expect = 8e-34 Identities = 64/70 (91%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHLIAIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 42 AKELTVPHLIAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 101 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 102 SRCPSAGSAY 111 >KHG19285.1 Cationic amino acid transporter 4, vacuolar -like protein [Gossypium arboreum] Length = 704 Score = 130 bits (327), Expect = 1e-33 Identities = 64/70 (91%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHLIAIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 42 AKELTVPHLIAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 101 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 102 SRCPSAGSAY 111 >XP_009343029.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X2 [Pyrus x bretschneideri] Length = 643 Score = 130 bits (326), Expect = 1e-33 Identities = 63/70 (90%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHL+AIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 48 AKELTVPHLVAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 107 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 108 SRCPSAGSAY 117 >XP_009366507.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like [Pyrus x bretschneideri] Length = 643 Score = 130 bits (326), Expect = 1e-33 Identities = 63/70 (90%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHL+AIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 48 AKELTVPHLVAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 107 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 108 SRCPSAGSAY 117 >XP_008386874.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X2 [Malus domestica] Length = 647 Score = 130 bits (326), Expect = 1e-33 Identities = 63/70 (90%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHL+AIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 48 AKELTVPHLVAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 107 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 108 SRCPSAGSAY 117 >XP_009343028.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X1 [Pyrus x bretschneideri] Length = 651 Score = 130 bits (326), Expect = 1e-33 Identities = 63/70 (90%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHL+AIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 48 AKELTVPHLVAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 107 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 108 SRCPSAGSAY 117 >XP_008386873.1 PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X1 [Malus domestica] Length = 655 Score = 130 bits (326), Expect = 1e-33 Identities = 63/70 (90%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTVPHL+AIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 48 AKELTVPHLVAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 107 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 108 SRCPSAGSAY 117 >KRG94900.1 hypothetical protein GLYMA_19G116500 [Glycine max] Length = 505 Score = 129 bits (323), Expect = 1e-33 Identities = 65/70 (92%), Positives = 67/70 (95%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELTV HLIA+GVGSTIGAGVYVLVG VAREHAGP+LAISFLIAGLAAGLSAFCYAELA Sbjct: 38 AKELTVLHLIAVGVGSTIGAGVYVLVGAVAREHAGPALAISFLIAGLAAGLSAFCYAELA 97 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 98 SRCPSAGSAY 107 >XP_008244218.1 PREDICTED: cationic amino acid transporter 2, vacuolar [Prunus mume] Length = 630 Score = 129 bits (325), Expect = 1e-33 Identities = 62/70 (88%), Positives = 68/70 (97%) Frame = +3 Query: 3 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 182 AKELT+PHL+AIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 46 AKELTIPHLVAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 105 Query: 183 CRCPSAGSAY 212 RCPSAGSAY Sbjct: 106 SRCPSAGSAY 115