BLASTX nr result
ID: Glycyrrhiza28_contig00005836
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00005836 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019227345.1 PREDICTED: eukaryotic translation initiation fact... 45 2e-06 XP_019227346.1 PREDICTED: eukaryotic translation initiation fact... 45 2e-06 >XP_019227345.1 PREDICTED: eukaryotic translation initiation factor isoform X1 [Nicotiana attenuata] OIT31446.1 eukaryotic translation initiation factor isoform 4g-1 [Nicotiana attenuata] Length = 776 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +1 Query: 223 LSFLSPGDSQFEGHERV*YTRDQLL*LRETGD 318 L + GDS+FEGHERV YTRDQLL LRE D Sbjct: 45 LPYFKTGDSRFEGHERVRYTRDQLLQLREVVD 76 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +2 Query: 116 MQVDGTV--LRPXXXXXXXXXXXXHSS--SDLPLLRPHGTSPFSL 238 MQ D TV LRP HSS SDLPLLRPHG SL Sbjct: 1 MQADQTVISLRPGGGGNRSRVLVGHSSTNSDLPLLRPHGGGSSSL 45 >XP_019227346.1 PREDICTED: eukaryotic translation initiation factor isoform X2 [Nicotiana attenuata] Length = 774 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +1 Query: 223 LSFLSPGDSQFEGHERV*YTRDQLL*LRETGD 318 L + GDS+FEGHERV YTRDQLL LRE D Sbjct: 45 LPYFKTGDSRFEGHERVRYTRDQLLQLREVVD 76 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +2 Query: 116 MQVDGTV--LRPXXXXXXXXXXXXHSS--SDLPLLRPHGTSPFSL 238 MQ D TV LRP HSS SDLPLLRPHG SL Sbjct: 1 MQADQTVISLRPGGGGNRSRVLVGHSSTNSDLPLLRPHGGGSSSL 45