BLASTX nr result
ID: Glycyrrhiza28_contig00001997
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00001997 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZP03156.1 hypothetical protein FIBSPDRAFT_505248, partial [Fibu... 70 1e-14 CQB88528.1 Uncharacterised protein [Chlamydia trachomatis] 62 2e-11 KIJ93785.1 hypothetical protein K443DRAFT_377952, partial [Lacca... 62 1e-10 KRZ01448.1 hypothetical protein T11_14937 [Trichinella zimbabwen... 53 1e-07 EUB53836.1 hypothetical protein EGR_11314 [Echinococcus granulosus] 53 3e-07 XP_005765668.1 hypothetical protein EMIHUDRAFT_79785 [Emiliania ... 50 4e-06 >KZP03156.1 hypothetical protein FIBSPDRAFT_505248, partial [Fibulorhizoctonia sp. CBS 109695] Length = 50 Score = 70.1 bits (170), Expect = 1e-14 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = +3 Query: 105 ACPSLGVLGNQDFYFEKIRVFKAGLCSNTLAWNNRIG 215 ACP LG GNQDFY EKIRVFKAGLC NTLAWNN IG Sbjct: 2 ACPLLGASGNQDFYLEKIRVFKAGLCPNTLAWNNEIG 38 >CQB88528.1 Uncharacterised protein [Chlamydia trachomatis] Length = 67 Score = 62.4 bits (150), Expect = 2e-11 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 126 LGNQDFYFEKIRVFKAGLCSNTLAWNNRIG 215 + NQDFYFEKIRVFKAGLCSN LAWNNRIG Sbjct: 1 MANQDFYFEKIRVFKAGLCSNILAWNNRIG 30 >KIJ93785.1 hypothetical protein K443DRAFT_377952, partial [Laccaria amethystina LaAM-08-1] Length = 117 Score = 61.6 bits (148), Expect = 1e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 126 LGNQDFYFEKIRVFKAGLCSNTLAWNNRIG 215 LGNQDFY EKIRVFKAG+C NTLAWNN+IG Sbjct: 71 LGNQDFYLEKIRVFKAGICPNTLAWNNKIG 100 >KRZ01448.1 hypothetical protein T11_14937 [Trichinella zimbabwensis] KRZ81136.1 hypothetical protein T08_11843 [Trichinella sp. T8] Length = 82 Score = 53.1 bits (126), Expect = 1e-07 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 3/67 (4%) Frame = -1 Query: 215 SYSIIP-C*CIRAKACFEHSNFFKVKVLVPQ-HAQ*RACGSPEGKARPDSAHR-KADRPA 45 SYSIIP C A+ACFEHSNFFKV P H+ G+P GK R + R ADRP Sbjct: 14 SYSIIPSCGIQAARACFEHSNFFKVNASGPAGHSAKSIEGAPRGKGRGRAVTRLAADRPP 73 Query: 44 RPEVRSR 24 P+++ R Sbjct: 74 APKIQLR 80 >EUB53836.1 hypothetical protein EGR_11314 [Echinococcus granulosus] Length = 124 Score = 53.1 bits (126), Expect = 3e-07 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 3/67 (4%) Frame = -1 Query: 215 SYSIIP-C*CIRAKACFEHSNFFKVKVLVPQ-HAQ*RACGSPEGKARPDSAHR-KADRPA 45 SYSIIP C A+ACFEHSNFFKV P H+ G+P GK R + R ADRP Sbjct: 56 SYSIIPSCGIQAARACFEHSNFFKVNASGPAGHSAKSIEGAPRGKGRGRAVARLAADRPP 115 Query: 44 RPEVRSR 24 P+++ R Sbjct: 116 APKIQLR 122 >XP_005765668.1 hypothetical protein EMIHUDRAFT_79785 [Emiliania huxleyi CCMP1516] XP_005776389.1 hypothetical protein EMIHUDRAFT_79134 [Emiliania huxleyi CCMP1516] XP_005783427.1 hypothetical protein EMIHUDRAFT_413798 [Emiliania huxleyi CCMP1516] XP_005790932.1 hypothetical protein EMIHUDRAFT_79409 [Emiliania huxleyi CCMP1516] EOD13239.1 hypothetical protein EMIHUDRAFT_79785 [Emiliania huxleyi CCMP1516] EOD23960.1 hypothetical protein EMIHUDRAFT_79134 [Emiliania huxleyi CCMP1516] EOD30998.1 hypothetical protein EMIHUDRAFT_413798 [Emiliania huxleyi CCMP1516] EOD38503.1 hypothetical protein EMIHUDRAFT_79409 [Emiliania huxleyi CCMP1516] Length = 109 Score = 50.1 bits (118), Expect = 4e-06 Identities = 28/54 (51%), Positives = 32/54 (59%) Frame = -1 Query: 185 RAKACFEHSNFFKVKVLVPQHAQ*RACGSPEGKARPDSAHRKADRPARPEVRSR 24 RA AC +HS+FFKVK P AQ R K P SA+ ADR ARPE+R R Sbjct: 54 RATACLKHSDFFKVKDPSPAPAQLRVGAVSGWKDAPASAYPSADRSARPEIRLR 107