BLASTX nr result
ID: Glycyrrhiza28_contig00001042
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00001042 (554 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016164669.1 PREDICTED: putative oxygen-evolving enhancer prot... 82 8e-16 XP_016165867.1 PREDICTED: oxygen-evolving enhancer protein 2, ch... 82 1e-15 XP_015973210.1 PREDICTED: oxygen-evolving enhancer protein 2, ch... 82 1e-15 XP_007155967.1 hypothetical protein PHAVU_003G2476001g, partial ... 80 2e-15 XP_014504521.1 PREDICTED: oxygen-evolving enhancer protein 2, ch... 81 3e-15 XP_017428978.1 PREDICTED: oxygen-evolving enhancer protein 2, ch... 81 3e-15 XP_004491279.1 PREDICTED: oxygen-evolving enhancer protein 2, ch... 81 3e-15 XP_003617328.1 oxygen-evolving enhancer protein 2-1 [Medicago tr... 81 4e-15 XP_015973208.1 PREDICTED: oxygen-evolving enhancer protein 2, ch... 80 4e-15 KYP73324.1 hypothetical protein KK1_005944 [Cajanus cajan] 80 5e-15 GAU22184.1 hypothetical protein TSUD_252120 [Trifolium subterran... 80 7e-15 XP_003532074.1 PREDICTED: oxygen-evolving enhancer protein 2, ch... 80 9e-15 KHN28540.1 Oxygen-evolving enhancer protein 2, chloroplastic [Gl... 80 9e-15 NP_001276136.1 oxygen-evolving enhancer protein 2, chloroplastic... 80 9e-15 XP_016165866.1 PREDICTED: oxygen-evolving enhancer protein 2, ch... 79 1e-14 XP_007141448.1 hypothetical protein PHAVU_008G196500g [Phaseolus... 79 1e-14 AGV54655.1 oxygen-evolving enhancer protein 2-2 chloroplast prec... 79 1e-14 AGV54458.1 oxygen-evolving enhancer protein 2 chloroplastic-like... 79 1e-14 KYP43014.1 hypothetical protein KK1_035549 [Cajanus cajan] 79 1e-14 XP_015167251.1 PREDICTED: putative oxygen-evolving enhancer prot... 74 2e-14 >XP_016164669.1 PREDICTED: putative oxygen-evolving enhancer protein 2-2 [Arachis ipaensis] Length = 236 Score = 82.0 bits (201), Expect = 8e-16 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGARRFVEN ASSFSVA Sbjct: 197 IRATVKDGKLYICKAQAGDKRWFKGARRFVENVASSFSVA 236 >XP_016165867.1 PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like [Arachis ipaensis] Length = 259 Score = 82.0 bits (201), Expect = 1e-15 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGARRFVEN ASSFSVA Sbjct: 220 IRATVKDGKLYICKAQAGDKRWFKGARRFVENAASSFSVA 259 >XP_015973210.1 PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like [Arachis duranensis] Length = 259 Score = 82.0 bits (201), Expect = 1e-15 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGARRFVEN ASSFSVA Sbjct: 220 IRATVKDGKLYICKAQAGDKRWFKGARRFVENAASSFSVA 259 >XP_007155967.1 hypothetical protein PHAVU_003G2476001g, partial [Phaseolus vulgaris] ESW27961.1 hypothetical protein PHAVU_003G2476001g, partial [Phaseolus vulgaris] Length = 180 Score = 79.7 bits (195), Expect = 2e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 I ATVKDGKLYICKAQAGDKRWFKGARRFVE+TASSFSVA Sbjct: 141 ITATVKDGKLYICKAQAGDKRWFKGARRFVESTASSFSVA 180 >XP_014504521.1 PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like [Vigna radiata var. radiata] Length = 261 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGAR+FVE+TASSFSVA Sbjct: 222 IRATVKDGKLYICKAQAGDKRWFKGARKFVESTASSFSVA 261 >XP_017428978.1 PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like [Vigna angularis] KOM46592.1 hypothetical protein LR48_Vigan07g029600 [Vigna angularis] BAT80815.1 hypothetical protein VIGAN_03042500 [Vigna angularis var. angularis] Length = 261 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGAR+FVE+TASSFSVA Sbjct: 222 IRATVKDGKLYICKAQAGDKRWFKGARKFVESTASSFSVA 261 >XP_004491279.1 PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like [Cicer arietinum] Length = 265 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGARRFVE+TA+SFSVA Sbjct: 226 IRATVKDGKLYICKAQAGDKRWFKGARRFVESTANSFSVA 265 >XP_003617328.1 oxygen-evolving enhancer protein 2-1 [Medicago truncatula] AET00287.1 oxygen-evolving enhancer protein 2-1 [Medicago truncatula] Length = 269 Score = 80.9 bits (198), Expect = 4e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGARRFVE+TA+SFSVA Sbjct: 230 IRATVKDGKLYICKAQAGDKRWFKGARRFVESTANSFSVA 269 >XP_015973208.1 PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like [Arachis duranensis] Length = 259 Score = 80.5 bits (197), Expect = 4e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGARRFVE++ASSFSVA Sbjct: 220 IRATVKDGKLYICKAQAGDKRWFKGARRFVEDSASSFSVA 259 >KYP73324.1 hypothetical protein KK1_005944 [Cajanus cajan] Length = 263 Score = 80.5 bits (197), Expect = 5e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKL+ICKAQAGDKRWFKGARRFVE+TASSFSVA Sbjct: 224 IRATVKDGKLFICKAQAGDKRWFKGARRFVESTASSFSVA 263 >GAU22184.1 hypothetical protein TSUD_252120 [Trifolium subterraneum] Length = 242 Score = 79.7 bits (195), Expect = 7e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGARR+VE+TA+SFSVA Sbjct: 203 IRATVKDGKLYICKAQAGDKRWFKGARRYVESTANSFSVA 242 >XP_003532074.1 PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic [Glycine max] KHM99676.1 Oxygen-evolving enhancer protein 2, chloroplastic [Glycine soja] KRH45981.1 hypothetical protein GLYMA_08G304200 [Glycine max] Length = 262 Score = 79.7 bits (195), Expect = 9e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 I ATVKDGKLYICKAQAGDKRWFKGARRFVE+TASSFSVA Sbjct: 223 IAATVKDGKLYICKAQAGDKRWFKGARRFVESTASSFSVA 262 >KHN28540.1 Oxygen-evolving enhancer protein 2, chloroplastic [Glycine soja] KRG99020.1 hypothetical protein GLYMA_18G114900 [Glycine max] Length = 265 Score = 79.7 bits (195), Expect = 9e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 I ATVKDGKLYICKAQAGDKRWFKGARRFVE+TASSFSVA Sbjct: 226 ITATVKDGKLYICKAQAGDKRWFKGARRFVESTASSFSVA 265 >NP_001276136.1 oxygen-evolving enhancer protein 2, chloroplastic-like [Glycine max] ACU18270.1 unknown [Glycine max] Length = 265 Score = 79.7 bits (195), Expect = 9e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 I ATVKDGKLYICKAQAGDKRWFKGARRFVE+TASSFSVA Sbjct: 226 ITATVKDGKLYICKAQAGDKRWFKGARRFVESTASSFSVA 265 >XP_016165866.1 PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like [Arachis ipaensis] Length = 259 Score = 79.3 bits (194), Expect = 1e-14 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGAR+FVE++ASSFSVA Sbjct: 220 IRATVKDGKLYICKAQAGDKRWFKGARKFVEDSASSFSVA 259 >XP_007141448.1 hypothetical protein PHAVU_008G196500g [Phaseolus vulgaris] ESW13442.1 hypothetical protein PHAVU_008G196500g [Phaseolus vulgaris] Length = 261 Score = 79.3 bits (194), Expect = 1e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGAR+FVE+T SSFSVA Sbjct: 222 IRATVKDGKLYICKAQAGDKRWFKGARKFVESTTSSFSVA 261 >AGV54655.1 oxygen-evolving enhancer protein 2-2 chloroplast precursor (OEE2) [Phaseolus vulgaris] Length = 261 Score = 79.3 bits (194), Expect = 1e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGAR+FVE+T SSFSVA Sbjct: 222 IRATVKDGKLYICKAQAGDKRWFKGARKFVESTTSSFSVA 261 >AGV54458.1 oxygen-evolving enhancer protein 2 chloroplastic-like protein [Phaseolus vulgaris] Length = 261 Score = 79.3 bits (194), Expect = 1e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATVKDGKLYICKAQAGDKRWFKGAR+FVE+T SSFSVA Sbjct: 222 IRATVKDGKLYICKAQAGDKRWFKGARKFVESTTSSFSVA 261 >KYP43014.1 hypothetical protein KK1_035549 [Cajanus cajan] Length = 225 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 I ATVKDGKLYICKAQAGDKRWFKGAR+FVE+TASSFSVA Sbjct: 186 ITATVKDGKLYICKAQAGDKRWFKGARKFVESTASSFSVA 225 >XP_015167251.1 PREDICTED: putative oxygen-evolving enhancer protein 2-2, partial [Solanum tuberosum] Length = 68 Score = 74.3 bits (181), Expect = 2e-14 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 554 IRATVKDGKLYICKAQAGDKRWFKGARRFVENTASSFSVA 435 IRATV DGKLYICKAQAGDKRWFKGA++FVEN A+SF++A Sbjct: 29 IRATVNDGKLYICKAQAGDKRWFKGAKKFVENAATSFTLA 68