BLASTX nr result
ID: Glycyrrhiza24_contig00031739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00031739 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625400.1| Pleiotropic drug resistance protein [Medicag... 139 2e-31 ref|XP_003625399.1| Pleiotropic drug resistance protein [Medicag... 139 2e-31 ref|XP_003625401.1| Pleiotropic drug resistance protein [Medicag... 138 4e-31 ref|XP_003625398.1| Pleiotropic drug resistance protein [Medicag... 138 5e-31 ref|XP_003625365.1| Pleiotropic drug resistance ABC transporter ... 137 7e-31 >ref|XP_003625400.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500415|gb|AES81618.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1398 Score = 139 bits (350), Expect = 2e-31 Identities = 68/79 (86%), Positives = 76/79 (96%) Frame = -2 Query: 237 DDEEALKWAAIQRLPTFARLRKGLLTSPQGEATEIDIKRLGLQEKRDLLERLVRLAEEDN 58 DDEEALKWAAIQ+LPTF RLRKGLLTS QGEATEID++ LGLQE++DLLERLVRLAEEDN Sbjct: 32 DDEEALKWAAIQKLPTFERLRKGLLTSLQGEATEIDVENLGLQERKDLLERLVRLAEEDN 91 Query: 57 EKFLLKLRNRVDRVGIDLP 1 EKFLLKL++R+DRVGIDLP Sbjct: 92 EKFLLKLKDRIDRVGIDLP 110 >ref|XP_003625399.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500414|gb|AES81617.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1469 Score = 139 bits (350), Expect = 2e-31 Identities = 68/79 (86%), Positives = 76/79 (96%) Frame = -2 Query: 237 DDEEALKWAAIQRLPTFARLRKGLLTSPQGEATEIDIKRLGLQEKRDLLERLVRLAEEDN 58 DDEEALKWAAIQ+LPTF RLRKGLLTS QGEATEID++ LGLQE++DLLERLVRLAEEDN Sbjct: 32 DDEEALKWAAIQKLPTFERLRKGLLTSLQGEATEIDVENLGLQERKDLLERLVRLAEEDN 91 Query: 57 EKFLLKLRNRVDRVGIDLP 1 EKFLLKL++R+DRVGIDLP Sbjct: 92 EKFLLKLKDRIDRVGIDLP 110 >ref|XP_003625401.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500416|gb|AES81619.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1483 Score = 138 bits (348), Expect = 4e-31 Identities = 68/79 (86%), Positives = 76/79 (96%) Frame = -2 Query: 237 DDEEALKWAAIQRLPTFARLRKGLLTSPQGEATEIDIKRLGLQEKRDLLERLVRLAEEDN 58 DDEEALKWAAIQ LPTFARLRKGLLTS QGEA EIDI++LGLQE++DLLERLVRLAEEDN Sbjct: 32 DDEEALKWAAIQNLPTFARLRKGLLTSLQGEAVEIDIEKLGLQERKDLLERLVRLAEEDN 91 Query: 57 EKFLLKLRNRVDRVGIDLP 1 EKFLLKL++R+DRVG+DLP Sbjct: 92 EKFLLKLKDRMDRVGVDLP 110 >ref|XP_003625398.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500413|gb|AES81616.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1444 Score = 138 bits (347), Expect = 5e-31 Identities = 67/79 (84%), Positives = 77/79 (97%) Frame = -2 Query: 237 DDEEALKWAAIQRLPTFARLRKGLLTSPQGEATEIDIKRLGLQEKRDLLERLVRLAEEDN 58 DDEEALKWAAIQ+LPTFARLRKGLL+ QGEATEID+++LGLQE++DLLERLVRLAEEDN Sbjct: 32 DDEEALKWAAIQKLPTFARLRKGLLSLLQGEATEIDVEKLGLQERKDLLERLVRLAEEDN 91 Query: 57 EKFLLKLRNRVDRVGIDLP 1 EKFLLKL++R+DRVGIDLP Sbjct: 92 EKFLLKLKDRIDRVGIDLP 110 >ref|XP_003625365.1| Pleiotropic drug resistance ABC transporter family protein [Medicago truncatula] gi|355500380|gb|AES81583.1| Pleiotropic drug resistance ABC transporter family protein [Medicago truncatula] Length = 649 Score = 137 bits (346), Expect = 7e-31 Identities = 66/79 (83%), Positives = 77/79 (97%) Frame = -2 Query: 237 DDEEALKWAAIQRLPTFARLRKGLLTSPQGEATEIDIKRLGLQEKRDLLERLVRLAEEDN 58 DDEE+LKWAAIQ+LPTF RLRKGLLTS QGEATE+D+++LGLQE++DLLERLVRLAEEDN Sbjct: 32 DDEESLKWAAIQKLPTFERLRKGLLTSLQGEATEVDVEKLGLQERKDLLERLVRLAEEDN 91 Query: 57 EKFLLKLRNRVDRVGIDLP 1 EKFLLKL++R+DRVGIDLP Sbjct: 92 EKFLLKLKDRMDRVGIDLP 110