BLASTX nr result
ID: Gardenia21_contig00051107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00051107 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13042.1| unnamed protein product [Coffea canephora] 69 1e-09 >emb|CDP13042.1| unnamed protein product [Coffea canephora] Length = 362 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 244 IWSSSRNIVLHCVSSPAILRKPFSSARFLFTHGGREAMN 128 I SS+RNIVLHCVSSPAIL+KPFSSARFLFT+ GRE MN Sbjct: 324 IRSSNRNIVLHCVSSPAILKKPFSSARFLFTNAGREGMN 362