BLASTX nr result
ID: Gardenia21_contig00050895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00050895 (282 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME43386.1| hypothetical protein DOTSEDRAFT_25336 [Dothistrom... 75 1e-11 >gb|EME43386.1| hypothetical protein DOTSEDRAFT_25336 [Dothistroma septosporum NZE10] Length = 84 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 141 MSGSQARVFSTEALEHPAQDHFASQYDLANPEVARTSYQKVMHEHTK 1 MSGS A V+STE LEHPAQD FA QYD+ NP+ A SYQ++MH+HTK Sbjct: 1 MSGSMAHVYSTEGLEHPAQDQFAQQYDIGNPDAAAKSYQRIMHQHTK 47