BLASTX nr result
ID: Gardenia21_contig00050524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00050524 (301 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07470.1| unnamed protein product [Coffea canephora] 81 3e-13 >emb|CDP07470.1| unnamed protein product [Coffea canephora] Length = 681 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 120 MSAYYPNLTGQQDVLQTQYLLNPKLNSYQSSDLPEIIYPN 1 MSAYYPNLT QQDVLQTQYLLNPKL SYQSSDLPEIIYPN Sbjct: 1 MSAYYPNLTSQQDVLQTQYLLNPKLTSYQSSDLPEIIYPN 40