BLASTX nr result
ID: Gardenia21_contig00050314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00050314 (223 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02065.1| unnamed protein product [Coffea canephora] 89 1e-15 >emb|CDP02065.1| unnamed protein product [Coffea canephora] Length = 945 Score = 89.0 bits (219), Expect = 1e-15 Identities = 47/72 (65%), Positives = 50/72 (69%) Frame = +3 Query: 6 EGIQDTNKLSQDMEEIPHNQLEILGTGNLECXXXXXXXXXXXXXXXVREVSDIPSMSKKE 185 EGIQDTN LSQDMEEI HNQLEILGTG EC VR VSD+ SMS+KE Sbjct: 22 EGIQDTNILSQDMEEITHNQLEILGTGCFECSISERGSSPYDRPESVRAVSDMLSMSEKE 81 Query: 186 SQTKEKHGNDTE 221 SQTKE HG+DTE Sbjct: 82 SQTKENHGDDTE 93