BLASTX nr result
ID: Gardenia21_contig00049626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00049626 (245 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00431.1| unnamed protein product [Coffea canephora] 57 4e-06 >emb|CDP00431.1| unnamed protein product [Coffea canephora] Length = 344 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 4/72 (5%) Frame = -3 Query: 240 GIKQYLGLVVK----VSTSRVKIEWQEHIALIANLLWNIWKSRNEAGFNSNTQPSFWIVT 73 GI+ G K +S + + E ++HIAL ANLLW +WK RN+ F + IV Sbjct: 257 GIQNQTGCFKKWWAALSQATSRTEGRQHIALTANLLWQLWKDRNQMEFEGKEREGLKIVQ 316 Query: 72 KSVNEWLEYKDA 37 K+ +EW+EY++A Sbjct: 317 KASSEWMEYEEA 328