BLASTX nr result
ID: Gardenia21_contig00048981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00048981 (200 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14352.1| unnamed protein product [Coffea canephora] 65 3e-08 emb|CDP18781.1| unnamed protein product [Coffea canephora] 60 5e-07 >emb|CDP14352.1| unnamed protein product [Coffea canephora] Length = 106 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = -1 Query: 200 LPLVSWLCTFCSTGRSSLSCSLK*FVVNKVIIPTVRGL 87 LPLVSWLCTFCST SSLS SLK FVVNKV IPT RGL Sbjct: 67 LPLVSWLCTFCSTHHSSLSYSLKRFVVNKVTIPTTRGL 104 >emb|CDP18781.1| unnamed protein product [Coffea canephora] Length = 111 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/38 (78%), Positives = 30/38 (78%) Frame = -1 Query: 200 LPLVSWLCTFCSTGRSSLSCSLK*FVVNKVIIPTVRGL 87 LPLVSWLCTFCS SSLS SLK VVNKV IPT RGL Sbjct: 72 LPLVSWLCTFCSARHSSLSYSLKRLVVNKVTIPTARGL 109