BLASTX nr result
ID: Gardenia21_contig00048821
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00048821 (354 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04793.1| unnamed protein product [Coffea canephora] 206 5e-51 ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythra... 127 2e-27 ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containi... 127 3e-27 emb|CBI21003.3| unnamed protein product [Vitis vinifera] 127 3e-27 ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containi... 127 3e-27 ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containi... 127 4e-27 ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containi... 124 2e-26 ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containi... 124 4e-26 ref|XP_010094870.1| hypothetical protein L484_016452 [Morus nota... 122 1e-25 ref|XP_007206864.1| hypothetical protein PRUPE_ppa1027201mg, par... 121 2e-25 ref|XP_008243860.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_007013815.1| Pentatricopeptide repeat superfamily protein... 116 6e-24 ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containi... 116 7e-24 ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containi... 113 6e-23 gb|KDO61668.1| hypothetical protein CISIN_1g043440mg, partial [C... 112 8e-23 ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citr... 112 8e-23 ref|XP_006364273.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_004245400.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 >emb|CDP04793.1| unnamed protein product [Coffea canephora] Length = 856 Score = 206 bits (524), Expect = 5e-51 Identities = 102/117 (87%), Positives = 107/117 (91%) Frame = -3 Query: 352 NSKKPISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILV 173 N KKPIS N GL +THVVESLLS RNDPAAAFKYFQWAE +RGFLRGVSDPYCVLLHILV Sbjct: 65 NWKKPISENPGLSQTHVVESLLSHRNDPAAAFKYFQWAEGQRGFLRGVSDPYCVLLHILV 124 Query: 172 SFPNEHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 S PNE+SL RRLLN YVSSDSSPSGILLFDHLISCS+RF+F LNSEVFNYLLNSYVR Sbjct: 125 SSPNEYSLTRRLLNSYVSSDSSPSGILLFDHLISCSERFDFPLNSEVFNYLLNSYVR 181 >ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Erythranthe guttatus] Length = 849 Score = 127 bits (320), Expect = 2e-27 Identities = 63/115 (54%), Positives = 80/115 (69%) Frame = -3 Query: 346 KKPISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSF 167 +KPIS N L + +VVE+LLS NDP +A YF+WAEK+RGF+R + D + VLLHILVS Sbjct: 60 QKPISENPRLSQANVVETLLSNFNDPRSALDYFRWAEKQRGFVREIGDSFLVLLHILVSS 119 Query: 166 PNEHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 H AR LLN Y+SSDS+PSG +L LI CS +F F + +F+Y LN YVR Sbjct: 120 HYHHGSARNLLNNYLSSDSAPSGGVLVQRLIDCSDKFGFRRSPRIFDYALNGYVR 174 >gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythranthe guttata] Length = 836 Score = 127 bits (320), Expect = 2e-27 Identities = 63/115 (54%), Positives = 80/115 (69%) Frame = -3 Query: 346 KKPISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSF 167 +KPIS N L + +VVE+LLS NDP +A YF+WAEK+RGF+R + D + VLLHILVS Sbjct: 60 QKPISENPRLSQANVVETLLSNFNDPRSALDYFRWAEKQRGFVREIGDSFLVLLHILVSS 119 Query: 166 PNEHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 H AR LLN Y+SSDS+PSG +L LI CS +F F + +F+Y LN YVR Sbjct: 120 HYHHGSARNLLNNYLSSDSAPSGGVLVQRLIDCSDKFGFRRSPRIFDYALNGYVR 174 >ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X3 [Vitis vinifera] Length = 1204 Score = 127 bits (319), Expect = 3e-27 Identities = 60/106 (56%), Positives = 80/106 (75%) Frame = -3 Query: 319 LRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPNEHSLARR 140 L + HV+++LL NDP +A +YF+ AE +RGF+RGV D YCVLLHIL+ P H AR+ Sbjct: 425 LSQNHVIDALLCHVNDPQSALRYFKRAETQRGFIRGV-DAYCVLLHILMRSPETHGHARK 483 Query: 139 LLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 LLN YVS DS PS ++ DHLI+C++RF+F L+ VFNYLLN+Y+R Sbjct: 484 LLNRYVSGDSDPSPVVFVDHLINCAKRFDFELDHRVFNYLLNAYIR 529 >emb|CBI21003.3| unnamed protein product [Vitis vinifera] Length = 837 Score = 127 bits (319), Expect = 3e-27 Identities = 60/106 (56%), Positives = 80/106 (75%) Frame = -3 Query: 319 LRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPNEHSLARR 140 L + HV+++LL NDP +A +YF+ AE +RGF+RGV D YCVLLHIL+ P H AR+ Sbjct: 58 LSQNHVIDALLCHVNDPQSALRYFKRAETQRGFIRGV-DAYCVLLHILMRSPETHGHARK 116 Query: 139 LLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 LLN YVS DS PS ++ DHLI+C++RF+F L+ VFNYLLN+Y+R Sbjct: 117 LLNRYVSGDSDPSPVVFVDHLINCAKRFDFELDHRVFNYLLNAYIR 162 >ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385776|ref|XP_010648630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385778|ref|XP_010648631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385781|ref|XP_010648632.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385783|ref|XP_010648633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385785|ref|XP_010648634.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] Length = 877 Score = 127 bits (319), Expect = 3e-27 Identities = 60/106 (56%), Positives = 80/106 (75%) Frame = -3 Query: 319 LRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPNEHSLARR 140 L + HV+++LL NDP +A +YF+ AE +RGF+RGV D YCVLLHIL+ P H AR+ Sbjct: 98 LSQNHVIDALLCHVNDPQSALRYFKRAETQRGFIRGV-DAYCVLLHILMRSPETHGHARK 156 Query: 139 LLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 LLN YVS DS PS ++ DHLI+C++RF+F L+ VFNYLLN+Y+R Sbjct: 157 LLNRYVSGDSDPSPVVFVDHLINCAKRFDFELDHRVFNYLLNAYIR 202 >ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39230, mitochondrial-like [Malus domestica] Length = 860 Score = 127 bits (318), Expect = 4e-27 Identities = 62/113 (54%), Positives = 81/113 (71%) Frame = -3 Query: 340 PISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPN 161 PIS ++ L +T V+ +LLS ++ P +A KYF+WAE+ RG +RGV D CVLLHIL+ PN Sbjct: 81 PISQDSELTQTSVISTLLSHKSKPYSAIKYFKWAERERGLVRGV-DAVCVLLHILMGSPN 139 Query: 160 EHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 H A+ LLN YVS DS P + DHL+ C++RF+F L S+VF YLLNSYVR Sbjct: 140 THERAKMLLNQYVSGDSGPVPGVFVDHLVDCAKRFDFELESQVFGYLLNSYVR 192 >ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070249|ref|XP_011081937.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070251|ref|XP_011081938.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070253|ref|XP_011081939.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] Length = 859 Score = 124 bits (312), Expect = 2e-26 Identities = 60/115 (52%), Positives = 81/115 (70%) Frame = -3 Query: 346 KKPISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSF 167 + P + N L + +VV++LLS NDP AA +YF+ EK+ GF+R + D + VLLHILVS Sbjct: 70 QNPFADNTRLSQIYVVDTLLSHINDPLAALEYFRSVEKQPGFVREIGDSFFVLLHILVSS 129 Query: 166 PNEHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 + H AR LLN Y+S DS+PSG++L D LI+CS+RF F L VF+YLLN YV+ Sbjct: 130 RDHHGAARNLLNNYLSGDSAPSGVVLVDRLINCSERFGFGLKPRVFDYLLNGYVK 184 >ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Pyrus x bretschneideri] gi|694405904|ref|XP_009377787.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X2 [Pyrus x bretschneideri] Length = 860 Score = 124 bits (310), Expect = 4e-26 Identities = 61/113 (53%), Positives = 80/113 (70%) Frame = -3 Query: 340 PISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPN 161 P S ++ L +T V+ +LLS ++ P +A KYF+WAE+ RGF+RGV D CVLLHIL+ PN Sbjct: 81 PTSQDSELTQTSVISTLLSHKSKPYSAVKYFKWAERERGFVRGV-DAVCVLLHILMGSPN 139 Query: 160 EHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 A+ LLN YVS DS P + DHL+ C++RF+F L S+VF YLLNSYVR Sbjct: 140 TQERAKMLLNQYVSGDSGPVPGVFVDHLVDCAKRFDFELESQVFGYLLNSYVR 192 >ref|XP_010094870.1| hypothetical protein L484_016452 [Morus notabilis] gi|587868026|gb|EXB57399.1| hypothetical protein L484_016452 [Morus notabilis] Length = 907 Score = 122 bits (305), Expect = 1e-25 Identities = 58/111 (52%), Positives = 78/111 (70%) Frame = -3 Query: 334 SVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPNEH 155 S++ L + HV+ +LLS +NDP +A KYF+WAE+ RGF+RGV D + VLLHIL+ H Sbjct: 79 SLSTDLTQAHVINTLLSHKNDPYSALKYFKWAERMRGFIRGV-DSFSVLLHILMGSQETH 137 Query: 154 SLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 A+ LL+ YVS DS PS + DHL C++RF F +S +FNYLLNSY+R Sbjct: 138 GSAQSLLSLYVSGDSGPSANVFVDHLFDCAKRFEFEPDSRIFNYLLNSYIR 188 >ref|XP_007206864.1| hypothetical protein PRUPE_ppa1027201mg, partial [Prunus persica] gi|462402506|gb|EMJ08063.1| hypothetical protein PRUPE_ppa1027201mg, partial [Prunus persica] Length = 782 Score = 121 bits (304), Expect = 2e-25 Identities = 60/106 (56%), Positives = 76/106 (71%) Frame = -3 Query: 319 LRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPNEHSLARR 140 L +T V+ +LLS R++P +A K+F WAEK RGFL+GV D +CVLLHIL F H A+ Sbjct: 3 LTQTKVISTLLSHRSEPNSALKHFIWAEKERGFLKGV-DAFCVLLHILTGFEETHVRAQI 61 Query: 139 LLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 LLN Y S DS PS + FD L+ C++RF+F L S VF+YLLNSYVR Sbjct: 62 LLNQYASGDSGPSQQVFFDRLVDCAKRFDFELESRVFSYLLNSYVR 107 >ref|XP_008243860.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Prunus mume] Length = 859 Score = 117 bits (294), Expect = 3e-24 Identities = 57/106 (53%), Positives = 76/106 (71%) Frame = -3 Query: 319 LRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPNEHSLARR 140 + +T V+ +LLS R++P +A ++F WAEK RGFL+GV D +CVLLHIL F H A+ Sbjct: 80 ITQTKVISTLLSHRSEPNSALEHFIWAEKERGFLKGV-DAFCVLLHILTRFEETHVRAQI 138 Query: 139 LLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 LLN Y S DS P+ + FD LI C++RF+F L S VF+YLLNSY+R Sbjct: 139 LLNQYASGDSGPAQQVFFDRLIDCAKRFDFELESRVFSYLLNSYIR 184 >ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697190350|ref|XP_009604240.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697190352|ref|XP_009604241.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] Length = 864 Score = 117 bits (292), Expect = 4e-24 Identities = 57/114 (50%), Positives = 78/114 (68%) Frame = -3 Query: 343 KPISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFP 164 +P S + G + HVV+ LLS R+DP +A++YFQ A +RGFL SDP+ VLLHILVS Sbjct: 75 RPFSKDGGFTKNHVVDVLLSHRDDPDSAYRYFQTARLQRGFLHTKSDPFFVLLHILVSCT 134 Query: 163 NEHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 ARRLL+ Y SDS PS ++F+ L++C + F+F LN VFN+L+NS V+ Sbjct: 135 MHQHKARRLLDNYAFSDSGPSATVIFNGLVNCCKAFDFELNPRVFNFLINSCVK 188 >ref|XP_007013815.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508784178|gb|EOY31434.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 1159 Score = 116 bits (291), Expect = 6e-24 Identities = 56/112 (50%), Positives = 79/112 (70%) Frame = -3 Query: 337 ISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPNE 158 ++ + L RTHV+ +LL RN+P +A KYF++ E +RGF+R + D +CVLLHILV Sbjct: 375 LTQDTSLTRTHVINTLLIHRNNPESALKYFRFVENKRGFVRSI-DVFCVLLHILVGSQQT 433 Query: 157 HSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 + + LLN +V+ DS P+ I+ DHLI ++RF+F L+S VFNYLLNSYVR Sbjct: 434 NKQVKYLLNRFVAGDSGPTPIVFLDHLIDIAKRFDFELDSRVFNYLLNSYVR 485 >ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474596|ref|XP_009784743.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474598|ref|XP_009784744.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474601|ref|XP_009784745.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] Length = 864 Score = 116 bits (290), Expect = 7e-24 Identities = 58/114 (50%), Positives = 79/114 (69%) Frame = -3 Query: 343 KPISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFP 164 KPIS + G + HVV+ LLS R+DP +A++YFQ A ++RGFL SDP+ VLLHILVS Sbjct: 75 KPISEDGGFTKNHVVDVLLSHRDDPDSAYRYFQTARQQRGFLHTKSDPFFVLLHILVSST 134 Query: 163 NEHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 ARRLL+ Y SDS PS ++F+ L++ + F+F LN VFN+L+NS V+ Sbjct: 135 MHQHKARRLLDNYAFSDSGPSATVVFNGLVNSYKAFDFELNPRVFNFLINSCVK 188 >ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122855|ref|XP_009615416.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122857|ref|XP_009615417.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122859|ref|XP_009615418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] Length = 864 Score = 113 bits (282), Expect = 6e-23 Identities = 56/114 (49%), Positives = 78/114 (68%) Frame = -3 Query: 343 KPISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFP 164 +P S + G + HVV+ LLS R+DP +A++YFQ A ++RGFL SDP+ VLLHILVS Sbjct: 75 RPNSEDGGFTKNHVVDVLLSHRDDPDSAYRYFQTARQQRGFLHTKSDPFFVLLHILVSST 134 Query: 163 NEHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 ARRLL+ Y SDS PS ++F+ L++ + F+F LN VFN+L+NS V+ Sbjct: 135 MHQHKARRLLDNYAFSDSGPSATVIFNGLVNSCKAFDFELNPRVFNFLINSCVK 188 >gb|KDO61668.1| hypothetical protein CISIN_1g043440mg, partial [Citrus sinensis] Length = 850 Score = 112 bits (281), Expect = 8e-23 Identities = 57/106 (53%), Positives = 75/106 (70%) Frame = -3 Query: 319 LRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPNEHSLARR 140 L +T V+ SLLS RN+P +AF+YF+ E+RRGFL+ + D +CVLLHIL+ H AR Sbjct: 4 LSQTSVISSLLSCRNEPVSAFEYFKRVERRRGFLKSL-DTFCVLLHILMKDRESHRYARN 62 Query: 139 LLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 LLN YVS S P+ + DHLI ++RF+F L+S VF+YLL SYVR Sbjct: 63 LLNHYVSGGSEPTSAAIIDHLIETAKRFDFDLDSGVFSYLLRSYVR 108 >ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] gi|568859583|ref|XP_006483317.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Citrus sinensis] gi|557553718|gb|ESR63732.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] Length = 850 Score = 112 bits (281), Expect = 8e-23 Identities = 57/106 (53%), Positives = 75/106 (70%) Frame = -3 Query: 319 LRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPNEHSLARR 140 L +T V+ SLLS RN+P +AF+YF+ E+RRGFL+ + D +CVLLHIL+ H AR Sbjct: 72 LSQTSVISSLLSCRNEPVSAFEYFKRVERRRGFLKSL-DTFCVLLHILMKDRESHRYARN 130 Query: 139 LLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 LLN YVS S P+ + DHLI ++RF+F L+S VF+YLL SYVR Sbjct: 131 LLNHYVSGGSEPTSAAIIDHLIETAKRFDFDLDSGVFSYLLRSYVR 176 >ref|XP_006364273.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565397380|ref|XP_006364274.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 854 Score = 111 bits (277), Expect = 2e-22 Identities = 54/113 (47%), Positives = 78/113 (69%) Frame = -3 Query: 340 PISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFPN 161 P S + +THVV+ LLS R+DP +A+++FQ A +RGFL SDP+ VLLHILV+ Sbjct: 65 PNSEDGKFTKTHVVDVLLSHRDDPDSAYRHFQTARLQRGFLHSKSDPFFVLLHILVNSAM 124 Query: 160 EHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 ARRLL+ Y SSDS PS ++F+ L+ C + F+F LN ++FN+L++S V+ Sbjct: 125 HQHKARRLLDYYASSDSGPSATIIFNGLVKCGKTFDFELNPKIFNFLISSCVK 177 >ref|XP_004245400.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722828|ref|XP_010325115.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722831|ref|XP_010325116.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722834|ref|XP_010325117.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722837|ref|XP_010325118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722840|ref|XP_010325119.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722845|ref|XP_010325120.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] Length = 850 Score = 108 bits (271), Expect = 1e-21 Identities = 52/114 (45%), Positives = 78/114 (68%) Frame = -3 Query: 343 KPISVNAGLRRTHVVESLLSRRNDPAAAFKYFQWAEKRRGFLRGVSDPYCVLLHILVSFP 164 +P S + + HVV+ LLS R+DP +A++YFQ A +RGFL SDP+ VLLHILV+ Sbjct: 60 RPNSEDVKFTKNHVVDVLLSHRDDPDSAYRYFQTARLQRGFLHSKSDPFFVLLHILVNSA 119 Query: 163 NEHSLARRLLNGYVSSDSSPSGILLFDHLISCSQRFNFALNSEVFNYLLNSYVR 2 +RRLL+ Y SSDS PS ++F+ L+ C + F+F LN ++FN+L++S ++ Sbjct: 120 MHQHKSRRLLDYYASSDSGPSATVVFNGLVKCGKTFDFGLNPKIFNFLVSSCMK 173