BLASTX nr result
ID: Gardenia21_contig00048820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00048820 (224 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03031.1| unnamed protein product [Coffea canephora] 59 1e-06 >emb|CDP03031.1| unnamed protein product [Coffea canephora] Length = 387 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 222 SSSVGPYNLEGLFFDKQIIADIVDKPETQQIF 127 S SVGPYNLEGLFF+KQ IAD+VD PETQQIF Sbjct: 356 SPSVGPYNLEGLFFNKQTIADVVDNPETQQIF 387