BLASTX nr result
ID: Gardenia21_contig00048769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00048769 (475 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00400.1| unnamed protein product [Coffea canephora] 53 2e-08 >emb|CDP00400.1| unnamed protein product [Coffea canephora] Length = 76 Score = 53.1 bits (126), Expect(2) = 2e-08 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 3/41 (7%) Frame = +3 Query: 213 MQQPMSTCVLRFHPFGDMPLLV---KNDRSEDPGLDDEGTR 326 +Q PMST VLRFHPF DMPLL+ K +RSED LDDEG + Sbjct: 7 LQHPMSTGVLRFHPFRDMPLLLVKRKKERSEDLRLDDEGEK 47 Score = 32.3 bits (72), Expect(2) = 2e-08 Identities = 17/24 (70%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +1 Query: 337 SSKTVHALIPF-YSVFMLAMLSSY 405 SS+ VHA IP YSVF+L MLSSY Sbjct: 53 SSRKVHAWIPLLYSVFILVMLSSY 76