BLASTX nr result
ID: Gardenia21_contig00048737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00048737 (254 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98299.1| unnamed protein product [Coffea canephora] 64 4e-08 >emb|CDO98299.1| unnamed protein product [Coffea canephora] Length = 284 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = -2 Query: 157 METEVNNSLITEKRANEAASVNPPTRRVRREADEADVNGSADEQGVDQSNEV 2 MET NSLI EKR EA+S+NPPT++ R EAD+NG+ DEQG DQSNEV Sbjct: 1 METGGKNSLIVEKREGEASSINPPTQQKMR---EADINGTVDEQGGDQSNEV 49