BLASTX nr result
ID: Gardenia21_contig00048610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00048610 (243 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14517.1| unnamed protein product [Coffea canephora] 115 1e-23 ref|XP_007131576.1| hypothetical protein PHAVU_011G024700g [Phas... 110 5e-22 ref|XP_014493331.1| PREDICTED: NAC transcription factor 29 [Vign... 107 3e-21 gb|ALC79005.1| NAC transcription factors 28 [Manihot esculenta] 107 3e-21 gb|ALC79008.1| NAC transcription factors 31 [Manihot esculenta] 107 5e-21 ref|XP_012480516.1| PREDICTED: NAC transcription factor 29-like ... 105 1e-20 gb|KRH29090.1| hypothetical protein GLYMA_11G096600 [Glycine max] 103 4e-20 gb|KOM51105.1| hypothetical protein LR48_Vigan08g193200 [Vigna a... 103 4e-20 ref|XP_012087679.1| PREDICTED: NAC transcription factor 29-like ... 103 4e-20 gb|KHN09257.1| Putative NAC domain-containing protein 94 [Glycin... 103 4e-20 gb|AGL39689.1| NAC transcription factor 033 [Jatropha curcas] gi... 103 4e-20 ref|NP_001242390.1| uncharacterized protein LOC100816770 [Glycin... 103 4e-20 ref|XP_010266117.1| PREDICTED: transcription factor JUNGBRUNNEN ... 103 7e-20 gb|KJB47737.1| hypothetical protein B456_008G038800 [Gossypium r... 102 9e-20 ref|XP_012436419.1| PREDICTED: putative NAC domain-containing pr... 102 9e-20 gb|KHN05484.1| Putative NAC domain-containing protein 94 [Glycin... 102 9e-20 ref|NP_001236900.1| NAC domain protein NAC6 [Glycine max] gi|625... 102 9e-20 gb|ACU23853.1| unknown [Glycine max] 102 9e-20 ref|XP_009341552.1| PREDICTED: NAC transcription factor 29 [Pyru... 102 1e-19 ref|XP_007041669.1| NAC domain containing protein 36 [Theobroma ... 102 1e-19 >emb|CDP14517.1| unnamed protein product [Coffea canephora] Length = 310 Score = 115 bits (288), Expect = 1e-23 Identities = 53/62 (85%), Positives = 56/62 (90%) Frame = +1 Query: 58 MEDSTTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLA 237 M+DSTT DLELPGFRFHPTEEELLDFYLK+ VLGKKL CDIIG LNIY HDPWDLPGLA Sbjct: 1 MDDSTTSSDLELPGFRFHPTEEELLDFYLKSTVLGKKLHCDIIGCLNIYDHDPWDLPGLA 60 Query: 238 KI 243 +I Sbjct: 61 RI 62 >ref|XP_007131576.1| hypothetical protein PHAVU_011G024700g [Phaseolus vulgaris] gi|561004576|gb|ESW03570.1| hypothetical protein PHAVU_011G024700g [Phaseolus vulgaris] Length = 303 Score = 110 bits (274), Expect = 5e-22 Identities = 48/62 (77%), Positives = 54/62 (87%) Frame = +1 Query: 58 MEDSTTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLA 237 MED ++ LPGFRFHPTEEELLDFYLKNMV+GKKL D+IG+LNIYHHDPWDLPGLA Sbjct: 4 MEDIAMSSEIALPGFRFHPTEEELLDFYLKNMVVGKKLRYDVIGFLNIYHHDPWDLPGLA 63 Query: 238 KI 243 K+ Sbjct: 64 KV 65 >ref|XP_014493331.1| PREDICTED: NAC transcription factor 29 [Vigna radiata var. radiata] Length = 292 Score = 107 bits (267), Expect = 3e-21 Identities = 47/62 (75%), Positives = 54/62 (87%) Frame = +1 Query: 58 MEDSTTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLA 237 MED + ++ LPGFRFHPTEEELLDFYLKNMV+GKKL D+IG+LNIYHHDPWDLP LA Sbjct: 4 MEDMSMSGEIALPGFRFHPTEEELLDFYLKNMVVGKKLRYDVIGFLNIYHHDPWDLPDLA 63 Query: 238 KI 243 K+ Sbjct: 64 KV 65 >gb|ALC79005.1| NAC transcription factors 28 [Manihot esculenta] Length = 295 Score = 107 bits (267), Expect = 3e-21 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +1 Query: 82 DLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAK 240 +L+LPGFRFHPTEEELLDFYLKNMV GKKL DIIGYLNIYHHDPWDLPG+AK Sbjct: 3 ELDLPGFRFHPTEEELLDFYLKNMVFGKKLRYDIIGYLNIYHHDPWDLPGMAK 55 >gb|ALC79008.1| NAC transcription factors 31 [Manihot esculenta] Length = 284 Score = 107 bits (266), Expect = 5e-21 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +1 Query: 85 LELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAK 240 L+LPGFRFHPTEEELLDFYLKNMV GKKL DIIGYLNIYHHDPWDLPG+AK Sbjct: 4 LDLPGFRFHPTEEELLDFYLKNMVFGKKLCLDIIGYLNIYHHDPWDLPGMAK 55 >ref|XP_012480516.1| PREDICTED: NAC transcription factor 29-like [Gossypium raimondii] gi|586637185|gb|AHJ79161.1| NAC domain protein NAC20 [Gossypium hirsutum] gi|763765472|gb|KJB32726.1| hypothetical protein B456_005G257800 [Gossypium raimondii] Length = 281 Score = 105 bits (262), Expect = 1e-20 Identities = 48/62 (77%), Positives = 54/62 (87%) Frame = +1 Query: 58 MEDSTTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLA 237 M+D+ TP +ELPGFRFHPTEEELL+FYLKNM+ KKL DIIGY NIYHHDPWDLPGL+ Sbjct: 7 MDDNATP-KIELPGFRFHPTEEELLEFYLKNMIYDKKLRYDIIGYHNIYHHDPWDLPGLS 65 Query: 238 KI 243 KI Sbjct: 66 KI 67 >gb|KRH29090.1| hypothetical protein GLYMA_11G096600 [Glycine max] Length = 302 Score = 103 bits (258), Expect = 4e-20 Identities = 48/63 (76%), Positives = 54/63 (85%), Gaps = 1/63 (1%) Frame = +1 Query: 58 MED-STTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGL 234 MED S ++ LPGFRFHPTEEELLDFYLKNMV+GKKL D+IG+LNIY HDPWDLPGL Sbjct: 7 MEDMSNMSGEITLPGFRFHPTEEELLDFYLKNMVVGKKLRYDVIGFLNIYQHDPWDLPGL 66 Query: 235 AKI 243 AK+ Sbjct: 67 AKV 69 >gb|KOM51105.1| hypothetical protein LR48_Vigan08g193200 [Vigna angularis] Length = 326 Score = 103 bits (258), Expect = 4e-20 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = +1 Query: 58 MEDSTTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPG 231 MED + ++ LPGFRFHPTEEELLDFYLKNMV+GKKL D+IG+LNIYHHDPWDLPG Sbjct: 4 MEDMSMSGEIALPGFRFHPTEEELLDFYLKNMVVGKKLRYDVIGFLNIYHHDPWDLPG 61 >ref|XP_012087679.1| PREDICTED: NAC transcription factor 29-like [Jatropha curcas] Length = 307 Score = 103 bits (258), Expect = 4e-20 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +1 Query: 82 DLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAK 240 +++LPGFRFHPTEEELLDFYLKNM+ GKKL D+IGYLNIYHHDPW+LPGLA+ Sbjct: 7 EMDLPGFRFHPTEEELLDFYLKNMIFGKKLCFDVIGYLNIYHHDPWELPGLAR 59 >gb|KHN09257.1| Putative NAC domain-containing protein 94 [Glycine soja] Length = 302 Score = 103 bits (258), Expect = 4e-20 Identities = 48/63 (76%), Positives = 54/63 (85%), Gaps = 1/63 (1%) Frame = +1 Query: 58 MED-STTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGL 234 MED S ++ LPGFRFHPTEEELLDFYLKNMV+GKKL D+IG+LNIY HDPWDLPGL Sbjct: 7 MEDMSNMSGEITLPGFRFHPTEEELLDFYLKNMVVGKKLRYDVIGFLNIYQHDPWDLPGL 66 Query: 235 AKI 243 AK+ Sbjct: 67 AKV 69 >gb|AGL39689.1| NAC transcription factor 033 [Jatropha curcas] gi|643710712|gb|KDP24735.1| hypothetical protein JCGZ_25336 [Jatropha curcas] Length = 304 Score = 103 bits (258), Expect = 4e-20 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +1 Query: 82 DLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAK 240 +++LPGFRFHPTEEELLDFYLKNM+ GKKL D+IGYLNIYHHDPW+LPGLA+ Sbjct: 4 EMDLPGFRFHPTEEELLDFYLKNMIFGKKLCFDVIGYLNIYHHDPWELPGLAR 56 >ref|NP_001242390.1| uncharacterized protein LOC100816770 [Glycine max] gi|255635325|gb|ACU18016.1| unknown [Glycine max] Length = 302 Score = 103 bits (258), Expect = 4e-20 Identities = 48/63 (76%), Positives = 54/63 (85%), Gaps = 1/63 (1%) Frame = +1 Query: 58 MED-STTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGL 234 MED S ++ LPGFRFHPTEEELLDFYLKNMV+GKKL D+IG+LNIY HDPWDLPGL Sbjct: 7 MEDMSNMSGEITLPGFRFHPTEEELLDFYLKNMVVGKKLRYDVIGFLNIYQHDPWDLPGL 66 Query: 235 AKI 243 AK+ Sbjct: 67 AKV 69 >ref|XP_010266117.1| PREDICTED: transcription factor JUNGBRUNNEN 1-like [Nelumbo nucifera] Length = 297 Score = 103 bits (256), Expect = 7e-20 Identities = 46/61 (75%), Positives = 52/61 (85%) Frame = +1 Query: 61 EDSTTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAK 240 + +TT D +LPGFRFHPTEEELLDFYL+ MV GK L DIIG+LNIYH+DPWDLPGLAK Sbjct: 5 QPTTTTPDYQLPGFRFHPTEEELLDFYLRKMVFGKNLHFDIIGFLNIYHYDPWDLPGLAK 64 Query: 241 I 243 I Sbjct: 65 I 65 >gb|KJB47737.1| hypothetical protein B456_008G038800 [Gossypium raimondii] Length = 286 Score = 102 bits (255), Expect = 9e-20 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +1 Query: 73 TPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAKI 243 T ++ELPGFRFHPTEEELL FYLKNM+ G KL D+IG+LNIYHHDPWDLPGL+KI Sbjct: 10 TTLEMELPGFRFHPTEEELLGFYLKNMIYGNKLRYDVIGFLNIYHHDPWDLPGLSKI 66 >ref|XP_012436419.1| PREDICTED: putative NAC domain-containing protein 94 [Gossypium raimondii] gi|763780665|gb|KJB47736.1| hypothetical protein B456_008G038800 [Gossypium raimondii] Length = 292 Score = 102 bits (255), Expect = 9e-20 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +1 Query: 73 TPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAKI 243 T ++ELPGFRFHPTEEELL FYLKNM+ G KL D+IG+LNIYHHDPWDLPGL+KI Sbjct: 10 TTLEMELPGFRFHPTEEELLGFYLKNMIYGNKLRYDVIGFLNIYHHDPWDLPGLSKI 66 >gb|KHN05484.1| Putative NAC domain-containing protein 94 [Glycine soja] gi|947075278|gb|KRH24118.1| hypothetical protein GLYMA_12G022700 [Glycine max] Length = 297 Score = 102 bits (255), Expect = 9e-20 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +1 Query: 82 DLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAKI 243 ++ LPGFRFHPTEEELLDFYLKNMV+GKKL D+IG+LNIY HDPWDLPGLAK+ Sbjct: 13 EITLPGFRFHPTEEELLDFYLKNMVVGKKLRYDVIGFLNIYQHDPWDLPGLAKV 66 >ref|NP_001236900.1| NAC domain protein NAC6 [Glycine max] gi|62546193|gb|AAX85983.1| NAC6 protein [Glycine max] gi|66394520|gb|AAY46126.1| NAC domain protein NAC6 [Glycine max] Length = 294 Score = 102 bits (255), Expect = 9e-20 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +1 Query: 82 DLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAKI 243 ++ LPGFRFHPTEEELLDFYLKNMV+GKKL D+IG+LNIY HDPWDLPGLAK+ Sbjct: 10 EITLPGFRFHPTEEELLDFYLKNMVVGKKLRYDVIGFLNIYQHDPWDLPGLAKV 63 >gb|ACU23853.1| unknown [Glycine max] Length = 201 Score = 102 bits (255), Expect = 9e-20 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +1 Query: 82 DLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAKI 243 ++ LPGFRFHPTEEELLDFYLKNMV+GKKL D+IG+LNIY HDPWDLPGLAK+ Sbjct: 13 EITLPGFRFHPTEEELLDFYLKNMVVGKKLRYDVIGFLNIYQHDPWDLPGLAKV 66 >ref|XP_009341552.1| PREDICTED: NAC transcription factor 29 [Pyrus x bretschneideri] Length = 294 Score = 102 bits (254), Expect = 1e-19 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = +1 Query: 61 EDSTTPCDLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAK 240 + TP + ELPGFRFHPTEEELL+FYLK+MV GK+L DIIG+LNIYHHDPWDLPGL+K Sbjct: 9 DQQMTP-EFELPGFRFHPTEEELLEFYLKSMVFGKRLRFDIIGFLNIYHHDPWDLPGLSK 67 Query: 241 I 243 I Sbjct: 68 I 68 >ref|XP_007041669.1| NAC domain containing protein 36 [Theobroma cacao] gi|508705604|gb|EOX97500.1| NAC domain containing protein 36 [Theobroma cacao] Length = 328 Score = 102 bits (254), Expect = 1e-19 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = +1 Query: 82 DLELPGFRFHPTEEELLDFYLKNMVLGKKLSCDIIGYLNIYHHDPWDLPGLAKI 243 ++ LPGFRFHPTEEELLDFYL+NM+ GKKL D+IG+LNIYHHDPWDLPGL+KI Sbjct: 51 EIGLPGFRFHPTEEELLDFYLRNMIYGKKLRYDVIGFLNIYHHDPWDLPGLSKI 104