BLASTX nr result
ID: Gardenia21_contig00048447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00048447 (369 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02177.1| unnamed protein product [Coffea canephora] 146 5e-33 >emb|CDP02177.1| unnamed protein product [Coffea canephora] Length = 556 Score = 146 bits (369), Expect = 5e-33 Identities = 71/88 (80%), Positives = 77/88 (87%) Frame = -1 Query: 264 NIVKAAPCLEEIDTKYRPVKIQNFCRRKTLYGRTKASRCRYISNPCVKPPRTSSVIARCK 85 NI+K AP LE+ TK+RPVKIQN CRRKT+YGRTKASRCRYISNPCVKP R SSVIARCK Sbjct: 243 NIMKEAPFLEDNATKHRPVKIQNLCRRKTIYGRTKASRCRYISNPCVKPQRMSSVIARCK 302 Query: 84 SYSISGKDVDKREHTSSKKQKISEAENG 1 SY+ISGKDVDK E TSSK Q I+EAENG Sbjct: 303 SYTISGKDVDKSERTSSKNQNITEAENG 330