BLASTX nr result
ID: Gardenia21_contig00047466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047466 (301 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME38935.1| hypothetical protein DOTSEDRAFT_75589 [Dothistrom... 57 4e-06 >gb|EME38935.1| hypothetical protein DOTSEDRAFT_75589 [Dothistroma septosporum NZE10] Length = 256 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -1 Query: 103 VMQFFIILSGLDTTPVNQVYFLQASTNGISNGN 5 V+QF +ILSGL++TP+NQ+YFLQA TNGI+NGN Sbjct: 21 VLQFLVILSGLNSTPLNQIYFLQADTNGITNGN 53