BLASTX nr result
ID: Gardenia21_contig00047434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047434 (588 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03690.1| unnamed protein product [Coffea canephora] 74 5e-11 ref|XP_011082600.1| PREDICTED: auxin-induced protein 22D-like [S... 74 7e-11 ref|XP_011079948.1| PREDICTED: auxin-induced protein 22D-like [S... 73 1e-10 gb|KHN18839.1| Auxin-induced protein 22D [Glycine soja] gi|94712... 73 1e-10 ref|XP_008438589.1| PREDICTED: auxin-responsive protein IAA4-lik... 73 1e-10 ref|XP_007162489.1| hypothetical protein PHAVU_001G156500g [Phas... 73 1e-10 ref|XP_004134103.1| PREDICTED: auxin-responsive protein IAA4 [Cu... 73 1e-10 sp|O24543.1|AX22E_VIGRR RecName: Full=Auxin-induced protein 22E;... 73 1e-10 sp|O24542.1|AX22D_VIGRR RecName: Full=Auxin-induced protein 22D;... 73 1e-10 gb|KRG92430.1| hypothetical protein GLYMA_20G210500 [Glycine max] 72 2e-10 gb|KOM25142.1| hypothetical protein LR48_Vigan50s006200 [Vigna a... 72 3e-10 gb|KCW60452.1| hypothetical protein EUGRSUZ_H03171 [Eucalyptus g... 72 3e-10 ref|XP_010024037.1| PREDICTED: auxin-induced protein 22D-like [E... 72 3e-10 ref|XP_006604480.1| PREDICTED: auxin-induced protein 22E-like [G... 72 3e-10 sp|P32294.1|AX22B_VIGRR RecName: Full=Auxin-induced protein 22B;... 72 3e-10 ref|XP_003521267.1| PREDICTED: auxin-induced protein 22E-like [G... 72 3e-10 ref|XP_014512035.1| PREDICTED: auxin-induced protein 22B [Vigna ... 71 4e-10 gb|KRH34375.1| hypothetical protein GLYMA_10G180000, partial [Gl... 71 4e-10 gb|KOM35582.1| hypothetical protein LR48_Vigan02g173200 [Vigna a... 71 4e-10 gb|KNA11147.1| hypothetical protein SOVF_138030 [Spinacia oleracea] 71 4e-10 >emb|CDP03690.1| unnamed protein product [Coffea canephora] Length = 96 Score = 73.9 bits (180), Expect = 5e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPWNMF TSCRRLRIM+ SEAKGLGCL Sbjct: 62 GDWMLVGDVPWNMFVTSCRRLRIMKESEAKGLGCL 96 >ref|XP_011082600.1| PREDICTED: auxin-induced protein 22D-like [Sesamum indicum] Length = 182 Score = 73.6 bits (179), Expect = 7e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPW+MF TSC+RLRIM+GSEAKGLGCL Sbjct: 148 GDWMLVGDVPWDMFITSCKRLRIMKGSEAKGLGCL 182 >ref|XP_011079948.1| PREDICTED: auxin-induced protein 22D-like [Sesamum indicum] Length = 198 Score = 72.8 bits (177), Expect = 1e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPW+MF TSCRRLRIM+GSEAKGL CL Sbjct: 164 GDWMLVGDVPWDMFVTSCRRLRIMKGSEAKGLACL 198 >gb|KHN18839.1| Auxin-induced protein 22D [Glycine soja] gi|947123132|gb|KRH71338.1| hypothetical protein GLYMA_02G142600 [Glycine max] Length = 202 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGC 486 GDWMLVGDVPWNMF +SC+RLRIM+GSEAKGLGC Sbjct: 168 GDWMLVGDVPWNMFVSSCKRLRIMKGSEAKGLGC 201 >ref|XP_008438589.1| PREDICTED: auxin-responsive protein IAA4-like [Cucumis melo] Length = 201 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPW MFT+SC+RLRIM+GSEAKGLGC+ Sbjct: 166 GDWMLVGDVPWEMFTSSCKRLRIMKGSEAKGLGCV 200 >ref|XP_007162489.1| hypothetical protein PHAVU_001G156500g [Phaseolus vulgaris] gi|561035953|gb|ESW34483.1| hypothetical protein PHAVU_001G156500g [Phaseolus vulgaris] Length = 205 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPWNMF +SC+RLRI++GSEAKGLGCL Sbjct: 171 GDWMLVGDVPWNMFVSSCKRLRIIKGSEAKGLGCL 205 >ref|XP_004134103.1| PREDICTED: auxin-responsive protein IAA4 [Cucumis sativus] gi|700201784|gb|KGN56917.1| hypothetical protein Csa_3G143580 [Cucumis sativus] Length = 204 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPW MFT+SC+RLRIM+GSEAKGLGC+ Sbjct: 169 GDWMLVGDVPWEMFTSSCKRLRIMKGSEAKGLGCV 203 >sp|O24543.1|AX22E_VIGRR RecName: Full=Auxin-induced protein 22E; AltName: Full=Indole-3-acetic acid-induced protein ARG14 gi|2224733|dbj|BAA20849.1| Aux22e [Vigna radiata] Length = 203 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPWNMF +SC+RLRI++GSEAKGLGCL Sbjct: 169 GDWMLVGDVPWNMFVSSCKRLRIIKGSEAKGLGCL 203 >sp|O24542.1|AX22D_VIGRR RecName: Full=Auxin-induced protein 22D; AltName: Full=Indole-3-acetic acid-induced protein ARG13 gi|2224731|dbj|BAA20848.1| Aux22d [Vigna radiata] Length = 193 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGC 486 GDWMLVGDVPWNMF +SC+RLRIM+GSEAKGLGC Sbjct: 159 GDWMLVGDVPWNMFVSSCKRLRIMKGSEAKGLGC 192 >gb|KRG92430.1| hypothetical protein GLYMA_20G210500 [Glycine max] Length = 194 Score = 72.4 bits (176), Expect = 2e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGC 486 GDWMLVGDVPW+MF TSCRRLRIM+GSEA+GLGC Sbjct: 159 GDWMLVGDVPWDMFVTSCRRLRIMKGSEARGLGC 192 >gb|KOM25142.1| hypothetical protein LR48_Vigan50s006200 [Vigna angularis] Length = 202 Score = 71.6 bits (174), Expect = 3e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPWNMF SC+RLRI++GSEAKGLGCL Sbjct: 168 GDWMLVGDVPWNMFVFSCKRLRIIKGSEAKGLGCL 202 >gb|KCW60452.1| hypothetical protein EUGRSUZ_H03171 [Eucalyptus grandis] Length = 143 Score = 71.6 bits (174), Expect = 3e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGC 486 GDWMLVGDVPW MF TSC+RLRIMRGSEA+GLGC Sbjct: 108 GDWMLVGDVPWEMFMTSCKRLRIMRGSEARGLGC 141 >ref|XP_010024037.1| PREDICTED: auxin-induced protein 22D-like [Eucalyptus grandis] gi|629094456|gb|KCW60451.1| hypothetical protein EUGRSUZ_H03171 [Eucalyptus grandis] Length = 203 Score = 71.6 bits (174), Expect = 3e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGC 486 GDWMLVGDVPW MF TSC+RLRIMRGSEA+GLGC Sbjct: 168 GDWMLVGDVPWEMFMTSCKRLRIMRGSEARGLGC 201 >ref|XP_006604480.1| PREDICTED: auxin-induced protein 22E-like [Glycine max] gi|734317056|gb|KHN02538.1| Auxin-induced protein 22E [Glycine soja] gi|947045984|gb|KRG95613.1| hypothetical protein GLYMA_19G161000 [Glycine max] Length = 204 Score = 71.6 bits (174), Expect = 3e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPWNMF +SC+RL+I++GSEAKGLGCL Sbjct: 170 GDWMLVGDVPWNMFVSSCKRLKIIKGSEAKGLGCL 204 >sp|P32294.1|AX22B_VIGRR RecName: Full=Auxin-induced protein 22B; AltName: Full=Indole-3-acetic acid-induced protein ARG4 gi|287568|dbj|BAA03309.1| hypothetical protein [Vigna radiata var. radiata] Length = 196 Score = 71.6 bits (174), Expect = 3e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPW+MF TSC+RLRIM+GSEA+GLGC+ Sbjct: 161 GDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGCV 195 >ref|XP_003521267.1| PREDICTED: auxin-induced protein 22E-like [Glycine max] gi|734345406|gb|KHN10704.1| Auxin-induced protein 22E [Glycine soja] gi|947119039|gb|KRH67288.1| hypothetical protein GLYMA_03G158600 [Glycine max] Length = 206 Score = 71.6 bits (174), Expect = 3e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPWNMF +SC+RL+I++GSEAKGLGCL Sbjct: 172 GDWMLVGDVPWNMFVSSCKRLKIIKGSEAKGLGCL 206 >ref|XP_014512035.1| PREDICTED: auxin-induced protein 22B [Vigna radiata var. radiata] Length = 182 Score = 71.2 bits (173), Expect = 4e-10 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGC 486 GDWMLVGDVPW+MF TSC+RLRIM+GSEA+GLGC Sbjct: 147 GDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGC 180 >gb|KRH34375.1| hypothetical protein GLYMA_10G180000, partial [Glycine max] Length = 122 Score = 71.2 bits (173), Expect = 4e-10 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGC 486 GDWMLVGDVPW+MF TSC+RLRIM+GSEA+GLGC Sbjct: 87 GDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGC 120 >gb|KOM35582.1| hypothetical protein LR48_Vigan02g173200 [Vigna angularis] Length = 190 Score = 71.2 bits (173), Expect = 4e-10 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGC 486 GDWMLVGDVPW+MF TSC+RLRIM+GSEA+GLGC Sbjct: 155 GDWMLVGDVPWDMFVTSCKRLRIMKGSEARGLGC 188 >gb|KNA11147.1| hypothetical protein SOVF_138030 [Spinacia oleracea] Length = 196 Score = 71.2 bits (173), Expect = 4e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 587 GDWMLVGDVPWNMFTTSCRRLRIMRGSEAKGLGCL 483 GDWMLVGDVPW MF TSC+RLRIM+ SEAKGLGCL Sbjct: 162 GDWMLVGDVPWEMFNTSCKRLRIMKSSEAKGLGCL 196