BLASTX nr result
ID: Gardenia21_contig00047425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047425 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13900.1| unnamed protein product [Coffea canephora] 92 2e-16 ref|XP_011084811.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_007011261.1| Pentatricopeptide repeat-containing protein,... 62 2e-07 ref|XP_009798485.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_010658171.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 emb|CBI25349.3| unnamed protein product [Vitis vinifera] 59 1e-06 ref|XP_009623481.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_002319343.2| hypothetical protein POPTR_0013s09430g, part... 58 2e-06 ref|XP_006358742.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_012839886.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 gb|EYU35195.1| hypothetical protein MIMGU_mgv1a024029mg, partial... 57 4e-06 ref|XP_004241092.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_011010139.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 >emb|CDP13900.1| unnamed protein product [Coffea canephora] Length = 855 Score = 92.0 bits (227), Expect = 2e-16 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIEDSLEVEDAV 211 SWIEVKN+VDVFFSGDSSSRKTIQIYEAL+SLRSNMKR EDSLEVEDAV Sbjct: 807 SWIEVKNQVDVFFSGDSSSRKTIQIYEALQSLRSNMKRTEDSLEVEDAV 855 >ref|XP_011084811.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Sesamum indicum] Length = 775 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIEDSLEVEDAV*E 205 SWIEVKNKVDVFFSGDSSS +T++IYE L SLR++MKR E E + + E Sbjct: 723 SWIEVKNKVDVFFSGDSSSPRTVKIYETLDSLRNSMKRKECHCEAGETIYE 773 >ref|XP_007011261.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508728174|gb|EOY20071.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 849 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIEDSLEVE 220 SWIE++NKVDVFFSGDSSS +T++IYE L SL NM++ E E++ Sbjct: 801 SWIELRNKVDVFFSGDSSSLRTMEIYEILHSLGRNMEKKEGDYEID 846 >ref|XP_009798485.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Nicotiana sylvestris] Length = 852 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIEDSLEVE 220 SWIEVKNK+DVFFS DSSS ++I+IYE L+SLRS MK E E+E Sbjct: 806 SWIEVKNKLDVFFSSDSSSPRSIEIYETLQSLRSIMKN-EGDYEIE 850 >ref|XP_010658171.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Vitis vinifera] Length = 855 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMK 247 SWIEVKN+VDVFFSGDSSS + I+IY+ L SL+SNM+ Sbjct: 807 SWIEVKNRVDVFFSGDSSSTRRIEIYKTLSSLKSNME 843 >emb|CBI25349.3| unnamed protein product [Vitis vinifera] Length = 1241 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMK 247 SWIEVKN+VDVFFSGDSSS + I+IY+ L SL+SNM+ Sbjct: 1193 SWIEVKNRVDVFFSGDSSSTRRIEIYKTLSSLKSNME 1229 >ref|XP_009623481.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Nicotiana tomentosiformis] Length = 852 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIED 235 SWIEVKNK+DVFFS DSSS +TI+IYE L+SLR MK D Sbjct: 806 SWIEVKNKLDVFFSSDSSSPRTIEIYETLQSLRIIMKNEGD 846 >ref|XP_002319343.2| hypothetical protein POPTR_0013s09430g, partial [Populus trichocarpa] gi|550325356|gb|EEE95266.2| hypothetical protein POPTR_0013s09430g, partial [Populus trichocarpa] Length = 792 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKR 244 SWIEV N +DVFFSGDSSS +TI+IY+ L SLR NM++ Sbjct: 745 SWIEVGNSIDVFFSGDSSSPRTIEIYDLLNSLRRNMRK 782 >ref|XP_006358742.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720-like [Solanum tuberosum] Length = 850 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIED 235 SWIEVKN+++VF+S DSSS KTI+IYE L+SLRS MK+ D Sbjct: 804 SWIEVKNELEVFYSCDSSSTKTIEIYETLQSLRSIMKKRGD 844 >ref|XP_012839886.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Erythranthe guttatus] Length = 860 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIEDSLE 226 SWIEVKNKVDVF+SGDSSS T++IYE L L+++M + + S E Sbjct: 808 SWIEVKNKVDVFYSGDSSSLSTVKIYETLDILKNSMTKKQCSFE 851 >gb|EYU35195.1| hypothetical protein MIMGU_mgv1a024029mg, partial [Erythranthe guttata] Length = 820 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIEDSLE 226 SWIEVKNKVDVF+SGDSSS T++IYE L L+++M + + S E Sbjct: 776 SWIEVKNKVDVFYSGDSSSLSTVKIYETLDILKNSMTKKQCSFE 819 >ref|XP_004241092.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Solanum lycopersicum] Length = 850 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIED 235 SWIEVKN+++VF+S DSSS KTI+IYE L+ LRS MK+ D Sbjct: 804 SWIEVKNELEVFYSSDSSSTKTIEIYETLQGLRSIMKKKGD 844 >ref|XP_011010139.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Populus euphratica] Length = 850 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -3 Query: 357 SWIEVKNKVDVFFSGDSSSRKTIQIYEALRSLRSNMKRIEDSLEVEDAV*E 205 SWIEV N +DVFFSGD SS +TI+IY+ L SLR NM++ E +A+ E Sbjct: 800 SWIEVGNSIDVFFSGDCSSPRTIEIYDLLNSLRRNMRKKGGHYESVEALQE 850